KEGG   Mycobacterium sp. MCS: Mmcs_3412Help
Entry
Mmcs_3412         CDS       T00367                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmcs_3412
   01230 Biosynthesis of amino acids
    Mmcs_3412
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmcs_3412
   00030 Pentose phosphate pathway
    Mmcs_3412
   00051 Fructose and mannose metabolism
    Mmcs_3412
   00052 Galactose metabolism
    Mmcs_3412
  Energy metabolism
   00680 Methane metabolism
    Mmcs_3412
Enzymes [BR:mmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mmcs_3412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3622051..3623025
Genome map
AA seq 324 aa AA seqDB search
MRRSGERTGHGPAIVTLTMNPALDITTSAPQVRPTSKIRCVGARYDPGGGGINVARTAHV
LGESVSAVFPVGGPTGDLVTELLGKADVPFRRIAIGDPTRESFTVNDDSSGQQYRFVLPG
PCLTAQEQAKCLEELRFEARAAQFVVASGSLPPGVPSDFYQRVADICRDVGARLILDTSG
DALQSVHSGVFLLKASVRELRERVGRDLLDRSDQLTAAQELIAAGVAEIIVVSLGSEGAL
LATSQGGHHFPPVPVEAVSGVGAGDAMVAAIAVGLTRGWSPTKSVQFGVATGAAMLLTPG
TEVCARADVERLFEATPEPEEIVG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagacggtccggcgaacgcacaggacacggaccggccatcgtcacgctgacgatgaac
ccggcgctcgacatcaccacgagcgcgccgcaggtccggccgaccagcaagatccgttgt
gtgggagcccgttacgaccctggaggcggtggcatcaacgtggcccgcaccgctcacgtc
ctcggcgagtcggtgtcggcggtgttccccgtgggcgggccgaccggcgacctggtcaca
gaactgctcggcaaggccgatgttccgttccgtcgtatcgcgatcggagatccgacgcgc
gagagcttcaccgtcaacgacgacagcagcggccagcagtaccggttcgtccttcccggc
ccctgtctgaccgcacaggaacaggcgaagtgtctggaggaactgcgtttcgaggcccgc
gcggcgcagttcgtggtggcaagtggcagcctgccgccgggcgttccctcggacttctac
cagcgggtcgccgacatctgccgcgacgtcggcgcacggctgatcctcgacacctcgggt
gacgccctccagagcgtccactcgggggtcttcctgctcaaagccagtgtgcgcgaacta
cgggagcgggtcggccgcgatctgctcgaccggtccgatcagctgaccgccgcacaggaa
ctcatcgccgccggcgtcgccgagatcatcgtggtgtccctgggttcggagggcgcgctg
ctggccacctcgcagggcggtcaccatttcccgccggtgcccgtggaggccgtcagtggt
gtcggcgcgggggacgcgatggtggcggcgatcgccgtcggcctgactcgcgggtggtcg
ccgaccaagtccgtgcagttcggggtcgccaccggagctgccatgttgttgacgccgggg
accgaggtgtgcgcacgagccgacgtggaacggctcttcgaagcgacgccggagcccgaa
gagattgtcggctaa

DBGET integrated database retrieval system