KEGG   Mycobacterium sp. MCS: Mmcs_3539Help
Entry
Mmcs_3539         CDS       T00367                                 

Definition
PfkB protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mmcs_3539
Enzymes [BR:mmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mmcs_3539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3765661..3766518
Genome map
AA seq 285 aa AA seqDB search
MAAARVCVVGSVNADLRFAVPSLPRPGQTVLASSMTTSPGGKGGNQAIAAARAGGDVSLV
AALGDDPAAGQLRAHLRANGVGLDGVVTVPGPSGSAVVIVDAAAENAIVVAPGANAHLSV
ASSAVREAIAGADVVLLQLEIPLHTANDAARVARDAGAVVMVNASPAGAPPHELLRLSEV
ADVVVVNQAEAGEWHWPVPHLVITRGARGASYLGDGERFDVPAPAVEAVDTTGAGDVFAG
VLAVHWRSGHENALRRACVAGALATLVPGAGDCAPTAEAIDDTLR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgcgtgtctgcgtggtgggcagtgtgaacgccgatctgcgcttcgcggtg
ccgtcgctaccgcgccccggccagaccgtcctcgcgtcctcgatgacgacctcgcccggc
ggcaagggtggcaatcaggcgatcgccgcggcgcgggccggcggcgacgtctcgctggtg
gcagcactcggcgacgacccggcggccgggcagttgcgcgctcacctgcgcgcgaacggg
gtcggcctcgacggtgtggtgacggtgcccggccccagcggctcggccgtcgtgatcgtc
gacgccgccgcggagaacgccatcgtcgtcgcgcccggcgccaatgcgcacctgagcgtg
gcgtcgtcggcggtgcgtgaggcgatcgccggggcggacgtcgtgctcctgcaactcgag
atcccactgcatacggcgaacgacgcggcccgggtggcgcgcgatgcgggcgcggtggtg
atggtgaacgcctcccccgcgggcgcgccgccccacgagctgctgaggctgtccgaagtg
gccgacgtggtggtggtcaatcaggccgaggccggtgaatggcattggccggttccgcat
ctggtcatcacccgcggcgcccgcggggcgagctacctcggtgacggtgagcggttcgac
gtcccggcacccgcggtcgaggccgtcgacaccaccggcgccggtgacgtgttcgccgga
gtgctggccgtgcattggcggtccggacacgagaacgcgttgcgccgcgcgtgcgtcgcg
ggcgcgctggccaccctggtacccggcgcgggtgactgcgctcccaccgccgaagcgatc
gacgacacattgagatga

  All links  
No link information was found.   
DBGET integrated database retrieval system