KEGG   Mycobacterium sp. MCS: Mmcs_3861Help
Entry
Mmcs_3861         CDS       T00367                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mmcs_3861
Enzymes [BR:mmc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mmcs_3861
Exosome [BR:mmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmcs_3861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4108087..4110366
Genome map
AA seq 759 aa AA seqDB search
MAKTKGLPKDTAVTPSPHLRPHTADLNRLLAGEHHDPHSILGAHEYDDHTVIRAYRPHAT
EVAAVVGGERHVFTHLEAGVFAVTLPFTGLIDYRLEVGYDHGGDQPHIHHTADAYRFLPT
LGEMDLHLFSEGRHERLWEVLGAHPRTFETPDGVVEGVSFAVWAPNANGVQLIGDFNHWD
GNEAQLRVLGSTGVWELFWPDFPVDGLYKFRIHGADGVVSERADPMAFATEVPPQTASRV
TTSSYTWNDDAWMTQRAAQNPVFEPMSTLEVHLMSWRPGLSYVELADQLTEYIVEHGFTH
VEMLPVAEHPFGGSWGYQVTSYYAPTSRLGTPDEFRYLVDRLHQAGIGVIVDWVPAHFPK
DAWALGRFDGTALYEHADPRRGEQLDWGTYVFDFGRAEVRNFLVANALYWLQEFHVDGLR
VDAVASMLYLDYSRPEGGWTPNIYGGRENLEAVQFLQEMNATVHKASPGIVTIAEESTSW
PGVTRPTNLGGLGFSMKWNMGWMNDTLAFISRDPIHRSYHHHEMTFSMLYAFSENYVLPI
SHDEVVHGKGTLWGRMLGDDHRKAAGVRQLLAYQWAHPGKQLLFQGQEFGQRAEWSEERG
VDWYQLDENSYSGGILRMISDMNGIYTSHRALWSHDTSPEGYSWIDANDSTNNVLSFLRY
GDDGSVLACVFNFSGSEHSQYRLGLPHAGTWREVLNTDAADYNGAGIGNYGAVQATDEPW
HGRPASAVMVLPPLSALWFEPVAAEAPVVQEPPTAPPLS
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacaaaaggactgccgaaagacaccgcggtgacccccagcccgcatctgcgg
ccgcacaccgccgacctgaaccggttgctcgccggtgagcaccacgacccgcattcgatc
ctcggggcgcacgaatacgacgaccacacggtgatccgggcgtaccgtccgcacgcgacc
gaggtcgcggccgtcgtcggcggcgaacgccacgtgttcacccacctcgaggccggcgtg
ttcgcggtgacgctgccgttcaccggcctgatcgactaccgcctcgaggtcggctacgac
cacggcggcgaccagccgcacatccaccacaccgccgacgcgtaccggttcctgcccacg
ctgggcgagatggacctgcacctgttctccgaggggcgccacgaacggttgtgggaggtg
ctcggggcgcatccgcgcaccttcgaaacccccgacggcgtcgtcgaaggcgtctcgttc
gccgtctgggcgcccaacgccaacggtgtgcagctgatcggcgacttcaaccactgggac
ggcaacgaggcgcagctgcgcgtcctcggttcgaccggggtgtgggagctgttctggccg
gacttcccggtcgacgggctctacaagttccgcatccacggcgccgacggcgtggtgagc
gagcgggccgacccgatggccttcgcgaccgaggtgccgccgcagaccgcatcgcgggtc
accacgagcagctacacgtggaacgacgacgcgtggatgacgcagcgcgccgcccagaac
ccggtgttcgagccgatgagcaccctcgaggtgcacctcatgtcgtggcggcccggcctg
tcgtacgtggagttggccgatcagctgaccgagtacatcgtcgagcacgggttcacccat
gtcgagatgctgccggtggccgagcacccgttcgggggttcgtggggttaccaggtcacg
tcgtactacgcgccgacctcgcgcctgggcacccccgacgagttccgctacctcgtcgac
cgactgcaccaggccggcatcggggtgatcgtcgactgggtgcccgcgcacttcccgaag
gacgcgtgggcgctgggccggttcgacggcaccgcactctacgaacacgccgacccccgc
cgcggtgaacagttggactggggcacatacgtcttcgacttcggccgggccgaggtgcgc
aacttcctggtcgccaacgcgctgtactggctgcaggagttccacgtcgacggactacgc
gtggacgccgtcgcctcgatgctctacctggactactcgcggcccgagggcggctggacg
ccgaacatctacggcggccgcgagaacctcgaggcggtgcagttcctccaggagatgaac
gccaccgtgcacaaggccagtccgggcatcgtgacgatcgccgaggagtcgacgtcgtgg
cccggcgtgacccgtccgaccaatctgggcgggctgggcttctcgatgaagtggaacatg
ggctggatgaacgacacgttggcgttcatcagccgcgaccccatccaccgcagctaccac
caccacgagatgacgttctcgatgctctacgcgttcagcgagaactacgtgctgccgatc
agccacgacgaggtggtgcacggtaagggcacgctgtggggccggatgctcggcgacgac
caccgcaaggccgcgggcgtgcggcagctgctggcctaccagtgggcgcaccccggtaag
cagttgctgttccagggccaggagttcggccagcgcgcggagtggtcggaggagcggggc
gtcgactggtaccaactcgacgagaacagctactcgggcggcatcctgcggatgatctcc
gacatgaacgggatctacaccagccaccgggcgctgtggtcacacgacaccagcccggag
gggtactcgtggatcgacgccaacgactcgacgaacaacgtactgagcttcctgcgctac
ggcgacgacggttcggtgctggcgtgtgtgttcaacttctccggctccgagcacagccag
taccggctgggcctgccgcacgccgggacgtggcgtgaggtgctcaacaccgacgcggcc
gactacaacggcgcgggcatcggcaactacggggcggtgcaggccaccgacgagccgtgg
cacggccggcccgcctcggcggtgatggtgctgccgccgctgtcggcgctgtggttcgag
ccggtggccgccgaggcgcccgtcgtccaggagcccccgactgcgccgccgctgtcctga

DBGET integrated database retrieval system