KEGG   Mycobacterium sp. MCS: Mmcs_3895Help
Entry
Mmcs_3895         CDS       T00367                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmcs_3895
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmcs_3895
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mmcs_3895
Enzymes [BR:mmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mmcs_3895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(4147387..4148469)
Genome map
AA seq 360 aa AA seqDB search
MSTPVNAVHRRWPGLIEAYRDRLPVGDDWTPVTLLEGGTPLIHAKRLSEFTGCTVHLKVE
GLNPTGSFKDRGMTVAVTESAASGKQAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKLTADFPTVALVNSVNPYRIEGQKTAAFEI
VDVLGTAPDIHALPVGNAGNITAYWKGYSEYHRDGLSDRLPRMLGTQAAGAAPLVTGEPV
KNPETIATAIRIGAPASWASAVEAQQQSDGRFLAATDEEILAAYHLVARTEGVFVEPASA
ASIAGLLKSVEDGWVAKGSTVVCTVTGNGLKDPDTALKGMPTVTPLAVDPVAVAAELGLV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccgtgaacgcggtgcaccggcgctggccggggctgatcgaggcctaccgc
gaccggcttcccgtcggcgacgactggacgccggtcaccctgctcgagggtggcacgccg
ctgatacacgccaagcggttgagcgaattcaccggctgcacagtgcatctgaaggtcgag
gggctcaacccgaccggttcgttcaaggaccgcgggatgacggtcgcggtcaccgagtcg
gcggccagcggtaagcaggcggtgctgtgcgcatcgacgggcaacacctccgcctcggca
gcggcgtatgcggcccgcgccggcatcacgtgtgcggtgctgatcccgcagggcaagatc
gcgatgggcaagctggcccaggcggtcatgcacggcgccaagatcatccagatcgacggg
aacttcgacgactgcctcgaactcgcccgcaagctgaccgccgacttcccgaccgtcgca
ctggtcaactcggtcaacccctaccgcatcgagggtcagaagaccgccgcgttcgagatc
gtcgacgtcctgggcactgcgcccgacatccacgctctgccggtcggcaacgcgggcaac
atcaccgcgtactggaagggctacagcgagtaccaccgcgacggcctgtccgaccggttg
ccccggatgctgggcacccaggcggcgggggccgcgccgctggtgaccggtgagcccgtg
aagaacccggagacgatcgccaccgcgatccgcatcggcgcccccgcgtcgtgggcgtcg
gcggtcgaagcccagcagcagtcggacggccgcttcctggcggcgaccgacgaggagatc
ctggcggcgtaccacctggtcgcgcgcaccgaaggagtcttcgtcgaaccggcctcggcg
gccagcatcgccgggctgctcaagtccgtcgaggacggttgggtggccaaggggtcgacc
gtggtgtgcaccgtcaccggcaacggactcaaggatcccgacaccgcgctcaagggaatg
cccaccgtcacaccgctcgccgtggatccggtggcggtggcggccgaactcggtctggtc
tga

DBGET integrated database retrieval system