KEGG   Mycobacterium sp. MCS: Mmcs_3917Help
Entry
Mmcs_3917         CDS       T00367                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mmcs_3917
Enzymes [BR:mmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Mmcs_3917
Transfer RNA biogenesis [BR:mmc03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Mmcs_3917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4170510..4171238)
Genome map
AA seq 242 aa AA seqDB search
MNDHELAARLATRAGDLLLDVRAEFADTSAEERKAAGDKWSHDFLMAELNEQRPGDAVLS
EEGADDPVRLRSQRVWIVDPLDGTREFSELDRDDWAVHVALWQSGELVAGAVALPAQNTT
LATPDVAAPRPLDGPPRIVVSRTRPPAIALAVRDALGGTLVEMGSAGAKVASIMQGLSDV
YVHAGGQYEWDSAAPVAVARAAGLHCSRIDGSPLIYNREDPKLPDLVVCRPELAEAVLAV
TR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgatcacgagctggccgcccggctcgccacccgggcgggcgacctgctgctcgac
gtacgtgcggagttcgccgacacctcggccgaggagcggaaagcggccggcgacaagtgg
tctcacgatttcctgatggccgaactcaacgagcaacggccgggtgacgcggtgctgtca
gaggaaggtgccgacgaccccgtgcggctgcgctcgcagcgggtgtggatcgtcgacccc
ctcgacggcacccgggagttctccgaactcgaccgcgacgactgggcggtccatgtggcg
ctgtggcagtccggtgaactggtggccggggcggtcgcgctgcccgcgcagaacaccacg
ctggccacccccgacgtcgccgcccccaggccgctcgacgggccaccgcggatcgtggtg
tcgcgcacccgcccacccgccatcgcgctcgcggtgcgtgacgcactcggtggcacgctc
gtcgaaatgggttcggccggagcgaaagtcgcctcgatcatgcaagggctctcggacgtc
tacgtgcacgcgggcggacagtacgagtgggattcggccgcgccggtcgcggtggcccgc
gccgccggactgcactgctcccgcatcgacggctcaccgctgatctacaaccgcgaggac
cccaagctgcccgatctggtggtgtgccgtccggaactggccgaggcggtgctggccgtc
acccgctga

DBGET integrated database retrieval system