KEGG   Mycobacterium sp. MCS: Mmcs_4012Help
Entry
Mmcs_4012         CDS       T00367                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmcs_4012
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mmcs_4012
Enzymes [BR:mmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Mmcs_4012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4278056..4279156)
Genome map
AA seq 366 aa AA seqDB search
MAPSSALRASGSSLDLRGDPVELTAALVDIPSESRHEQRIADEIEAALREQTDGFEIIRN
GDAVLARTNRGLPSRVLLAGHIDTVPAADNVPSRRVGDELHGCGTSDMKSGDAVFLHLAA
TVADPAHDLTLVMYDCEEIEASANGLGRIERELPEWLQADVAILGEPSGGFIEAGCQGTL
RVVVSATGTRAHSARSWLGDNAIHKLGAVLDRLAAYQARSIDIDGCVYREGLSAVRIDGG
IAGNVIPDAASVTVNFRFAPDRTVDQALAHVHEVLDGLDVTVEQTDAAAGALPGLTRPAA
AALVEAAGGQARAKYGWTDVARFAALGIPAVNYGPGDPNLAHRADERVDVGQITATTEVL
RRYLTA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggccccatcatcggctcttcgcgcaagcggctcatcgctggatctccgtggtgacccg
gtcgagctgacggccgcactcgtcgacatccccagcgagtcgcgccacgagcagcgcatc
gccgacgagatcgaggccgcactgcgcgaacagacagacggtttcgagatcatccgcaac
ggcgacgcggtgctggcccgcaccaaccgggggctcccgtcacgcgtgctgctggccggg
cacatcgacaccgtgcccgccgccgacaacgtccccagccgccgggtcggtgacgagctg
cacggctgcggcacctccgacatgaagtccggggacgcggtgttcctgcacctcgccgcc
actgtcgccgaccccgcacacgacctcacgctggtgatgtacgactgcgaagagatcgag
gcgtcggccaacgggctcggccgcatcgaacgcgaactgcccgagtggctgcaggccgac
gtcgcgatcctcggcgaaccgtccggcggtttcatcgaggccggctgccagggcacgctg
cgagtcgtggtgagcgccaccggaacccgggcgcactccgcgcgatcctggttgggcgac
aacgccattcacaaactcggcgcggtcctcgaccggttggccgcctaccaggcccgcagc
atcgacatcgacggctgcgtctaccgcgagggactctccgcggtgcgcatcgacggcggc
atcgcgggcaacgtgatccccgacgccgcctcggtcaccgtcaacttccgcttcgccccc
gaccgcaccgtcgaccaggcgctggcccacgtccacgaggtcctcgacggactcgacgtc
accgtcgagcagaccgacgccgccgccggagccctgccggggctgaccaggccggcggcc
gcggcgctggtcgaggccgccggcggacaggcgcgggccaagtacgggtggaccgacgtg
gcgcggttcgcggcgctggggatcccggccgtcaattacggtccgggggatccgaacctc
gcccaccgcgcggacgaacgggtcgacgtcggccagatcaccgcgaccaccgaggtgctg
cgccggtatttaaccgcttga

DBGET integrated database retrieval system