KEGG   Mycobacterium sp. MCS: Mmcs_4290Help
Entry
Mmcs_4290         CDS       T00367                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mmcs_4290
   00052 Galactose metabolism
    Mmcs_4290
   00500 Starch and sucrose metabolism
    Mmcs_4290
   00520 Amino sugar and nucleotide sugar metabolism
    Mmcs_4290
Enzymes [BR:mmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mmcs_4290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4558031..4558903)
Genome map
AA seq 290 aa AA seqDB search
MPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVIITSEGKDGVVAHF
VEDLVLEGTLEARGKKTMLEKVRRAPALIKVESVVQAEPLGLGHAVSCVEPTLSDDEDAI
AVLLPDDLVLPTGVLETMSKVRAKRGGSVLCAIEVPPEKISAYGVFDVEEVPDATNPNVL
RVKGMVEKPKAEDAPSPYAAAGRYVLDRAIFDALRRVKRGAGNEIQLTDAIALLIEEGHP
VHVVVHRGTRHDLGNPGGYLKAAVDFALERDDYGPELRQWLVERLGLTEN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgccgcaggcctgggcacgcgtttcctccccgccaccaagacggtgcccaaggaa
ttgctgccggtcgtggacacccccgggatcgagttggtggccgccgaggccgcggaggcg
ggcgccgaacggctcgtcatcatcacgtccgagggcaaggacggcgtggtcgcgcacttc
gtcgaggacctggtgctcgaggggacgctcgaggcccgcggtaagaagaccatgctcgag
aaggtgcggcgcgcgcccgcgctgatcaaggtggaatcggtggttcaggccgaaccgctc
ggcctcggtcacgccgtcagctgcgtggagcccacgctgtccgacgacgaggatgcgatc
gcggtgctgctgcccgacgacctcgtgctgccgaccggtgttctcgagacgatgtcgaag
gtgcgcgcgaaacgcggcggttcggtgttgtgcgcgatcgaggtgccgcccgagaagatc
agcgcctacggcgtattcgacgtcgaagaggtgcccgacgccaccaaccccaacgtcctg
cgcgtcaaggggatggtcgagaaacccaaggccgaggatgccccgtcgccgtacgccgcg
gccggccgctacgtgttggaccgagcgatcttcgacgcgctgcgacgtgtcaagcggggt
gcgggcaacgagatccagctgaccgacgcgatcgcgctgctgatcgaggagggccatccg
gtgcacgtggtggtccaccgcggaacccgacacgacctgggaaatcccggcggctacctc
aaggctgcggttgactttgcgttggaacgcgacgactacggccccgagctgcggcagtgg
ttggtcgagcgattgggcctgaccgagaactag

DBGET integrated database retrieval system