KEGG   Mycobacterium sp. MCS: Mmcs_4660Help
Entry
Mmcs_4660         CDS       T00367                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00360  Phenylalanine metabolism
mmc00362  Benzoate degradation
mmc00620  Pyruvate metabolism
mmc00621  Dioxin degradation
mmc00622  Xylene degradation
mmc00650  Butanoate metabolism
mmc01100  Metabolic pathways
mmc01120  Microbial metabolism in diverse environments
mmc01220  Degradation of aromatic compounds
Module
mmc_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mmcs_4660
   00650 Butanoate metabolism
    Mmcs_4660
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Mmcs_4660
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmcs_4660
   00622 Xylene degradation
    Mmcs_4660
   00621 Dioxin degradation
    Mmcs_4660
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mmcs_4660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABG10764
JGI: Mmcs4660
UniProt: Q1B2X0
Position
complement(4937320..4938252)
Genome map
AA seq 310 aa AA seqDB search
MPEKLQVAIVGSGNISTDLLYKLQRSEYLEPRWMIGIDPESEGLARARKLGLETSHEGVD
WLLAQDDKPDLVFEATSAYVHRAAAPRYEEAGIRAIDLTPAAVGPAVIPPANLREHLDAP
NVNMITCGGQATIPIVYAVTRAVTEQGGTVPYAEIVASVSSSSAGPGTRANIDEFTKTTS
KGVQTIGGAARGKAIIILNPADPPMIMRDTIFCAIPEDVDRDAIAQSIRDVVAEVQTYVP
GYRLLNDPQFDDPSINSGGQAVVTTFVEVEGAGDYLPPYAGNLDIMTAAAAKVGEEIAKE
SLSLAGGAQA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccggagaagcttcaggtcgcgatcgtcgggtccggcaacatcagcaccgatctgctg
tacaagctgcagcgctcggagtacctcgaaccgcgttggatgatcggaatcgatcccgag
tccgaagggctcgcgcgcgcacgcaaactcggcctcgagacctcgcacgagggcgtggat
tggctgctcgcccaggacgacaaaccggatctggtgttcgaggccaccagcgcctacgtg
caccgggcggcggcaccgcgctacgaggaagcgggtatccgcgccatcgacctcaccccg
gccgcggtgggcccggcggtgatcccgccggccaacctgcgcgaacacctcgacgcaccg
aacgtcaacatgatcacctgtggtgggcaggccaccatccccatcgtctacgcggtcacc
cgcgcggtcaccgaacagggcggcacggtgccctacgccgagatcgtcgcctcggtgtcg
tcgagttcggcgggtccgggtacccgcgccaacatcgacgagttcaccaagaccaccagc
aagggtgtgcagaccatcggcggtgccgcgcgggggaaggcgatcatcatcctcaacccc
gccgatccgccgatgatcatgcgcgacaccatcttctgtgccatccccgaggacgtcgac
cgggatgcgatcgcccagtcgatccgcgacgtcgtcgccgaggtgcagacctacgtaccc
ggctaccgcctgctcaacgacccgcagttcgacgacccctcgatcaactccggcggacag
gccgtggtcaccacgttcgtggaggtggaaggcgcaggcgactacctgccgccgtacgcg
ggaaacctcgacatcatgaccgccgcggcggccaaggtgggcgaggagatcgcaaaggaa
tccctttctctggcaggaggtgcgcaggcatga

DBGET integrated database retrieval system