KEGG   Mycobacterium sp. MCS: Mmcs_4766Help
Entry
Mmcs_4766         CDS       T00367                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5043036..5043566)
Genome map
AA seq 176 aa AA seqDB search
MTRVVLSIGSNVGDRLARLQSVVDGLGEAVRAVSPVYETAAWGGVEQGAFLNAVLIADDP
DLDCHGWLRRGQQLEQEADRVRGQRWGPRTLDVDIVTCHDGDTEVRSATAELTLPHPYAH
LRGFVLMPWLAAEPEATLTVADTTRPVSLWLEELDYAERAGVRRTDLALRTEIAAD
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtgacacgagtcgtgttgtccatcgggtcgaatgtgggtgaccgcctggcacgcctgcag
tccgtcgtcgacggtctcggggaggccgtgcgcgcggtgtcgccggtgtacgagaccgcg
gcgtggggcggtgtcgaacagggcgccttcctcaacgcggtgctgatcgccgacgacccc
gacctcgactgccacggctggctgcgccgcggtcagcagttggagcaggaggccgaccgg
gtccgcggacagcggtgggggccccgcaccctcgacgtcgacatcgtcacctgccacgac
ggggacaccgaagtgcgttccgcgactgcggagctcacgctgccgcatccgtacgcacat
ctgcgggggttcgtcctgatgccgtggctggcggccgaaccggaggcgacgctgacggtg
gcggacacgacacggccggtctcgctgtggctggaggaactcgactacgccgagcgcgcg
ggtgtgcggcgcaccgacctggccctgcgcacggagatcgcggccgactga

DBGET integrated database retrieval system