KEGG   Mycobacterium sp. MCS: Mmcs_5319Help
Entry
Mmcs_5319         CDS       T00367                                 

Definition
P type cation/copper-transporter ATPase
Orthology
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
mmc  Mycobacterium sp. MCS
Brite
Enzymes [BR:mmc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.4  Cu2+-exporting ATPase
     Mmcs_5319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5602609..5604702)
Genome map
AA seq 697 aa AA seqDB search
MTDPHRHRDAPVAAGVRPVDHAGSDTHSHDTHGHDGHGGDHVAQFRRLFWVNLVIAIPVV
AFSTMFAMLIGYRLPDFPGARWIAPLLGTVMYAVGGRPFLTGARSEIRSRKPGMMLLIGL
AITVAFVASWGATLGLLHHELEFWWELALLIVIMLLGHWVEMRSLAQTTSALDSLAALLP
DEAEKIDGDRTVIVPPADLRVGDVVVVRPGGSVPADGRIVDGRADMDESMVTGESRPIAR
GVGDAVTAGTVATDSGLRVEITATGDDTTLAGIQRLVTEAQNSSSRAQRLADRAAGWLFW
FALATAAVTAVVWTMAGSPDASVVRAITVLVIACPHALGLAIPLVVSIATERAARGGVLV
KDRLSLESMRTVNAVLFDKTGTLTKGEPTLVAIEPVGTLGADGVLALAAAAESDSEHPLA
RAIVRAAEERGLTVPRATGFSSAPAVGVTATVDGREIRIGGPRLLDEVGAEEVGTAAAWR
EEGAIILHVVRDGDVVGGLRLADEVRHESREAVEALHKLGIEVVMITGDAEAVAHAVGDE
LGIDRVFAGVRPEDKAAKVSGLQREGRKVAMVGDGVNDAPALAQADVGIAIGAGTDVAIA
SAGVILASSDPRSVLSVIELSRASYRKMKQNLWWGAGYNLIAVPLAAGVLAPIGFVLPMS
VGAILMSLSTVVVALNAQLLRRIDLRPEASTRAILDR
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacccccaccgtcatcgcgacgctcctgtggcagcgggtgtccgcccggtcgac
cacgccggctctgacacccacagccatgacacccacggccatgacggccatggcggtgat
cacgtcgcgcagtttcggcggttgttctgggtcaacctggtcatcgcaatacccgtcgtc
gcgttctcgaccatgttcgcgatgctgatcggctatcggctccccgacttcccgggcgcc
cggtggatcgcacccctcctcggtacggtgatgtacgccgtcggcgggcggcccttcctg
accggcgcgaggagcgaaatccgttctcgcaaaccgggaatgatgttgctgatcggcctg
gccatcaccgtcgcgttcgtcgcgtcctggggcgccaccctcgggctgctccaccacgaa
ctggagttctggtgggagctggcgttgctcatcgtcatcatgctgctcggtcactgggtc
gagatgcggtcactggcccagacgacctccgcattggattcgcttgcggcgctgctcccc
gacgaagccgagaagatcgacggtgaccgcaccgtcatcgtgcccccggcggatctgcgc
gtcggtgacgtggtggtcgtacggccgggtggcagcgtcccggcggacggccggatcgtc
gacggccgcgcggacatggacgagtcaatggtgaccggagagtccagaccgatcgcccgc
ggtgtcggcgacgccgttacggccggcaccgtagccaccgactccggactgcgggtcgag
atcaccgccacgggcgacgacaccaccctggccgggatccagcgtctggtgaccgaggcg
cagaactcgtcgtcgcgagcacagcgcctcgccgaccgggcggccggctggctgttctgg
ttcgccttggccaccgcggcggtcacggcggtggtgtggacgatggccggcagccccgac
gcgtcggtcgtgcgagcgatcaccgtgctggtcatcgcatgcccacatgcgctgggtctg
gcgatcccgctggtcgtgtccatcgccaccgaacgggccgcccgaggcggcgtgctggtc
aaggaccggctgtcgctggagagtatgcgcaccgtcaacgccgtgctgttcgacaagacc
ggcaccctgaccaagggcgaaccgacgctcgttgcgatcgaaccggtcggcactctcggc
gccgacggtgtgttggcgctggcggccgcggcggagagcgacagcgagcaccccctggcg
cgggcgatcgtgcgcgccgccgaggagcgtggcctcaccgtgccacgcgccaccgggttc
tcctccgctccggctgtcggggtgaccgcgaccgtcgacggacgggagatccggatcggg
ggtccccgcctgctcgacgaggtcggcgcagaggaagtcgggaccgcggcggcgtggcgg
gaggagggcgcgatcatcctgcacgtcgtccgcgacggcgacgtggtcggcggcctccgc
ctggccgacgaggtgcgccacgaatcccgcgaagccgtcgaggcgctgcacaagctgggc
atcgaggtggtcatgatcaccggtgacgcggaagccgtcgcccatgccgtcggcgatgag
ctcggcatcgaccgggtgttcgcaggcgtgcgtccggaggacaaggccgccaaggtatcc
gggctgcagcgcgagggcaggaaggtcgccatggtgggcgacggggtcaatgacgccccc
gcgctcgcacaggccgacgtcgggatcgcgatcggcgccggcaccgacgtcgcgatcgcg
tcggccggtgtcatcctggcgagctcggatcctcgttcggtcctctcggtgatcgagctg
tcccgggcgagctatcgcaagatgaagcagaacctctggtggggtgcgggatacaacctc
atcgccgtgccgctggccgccggggttctggcgccgatcggtttcgtcctgccgatgtcg
gtcggggcgatcctgatgtcgctgtcgacggtggtcgtggcgctcaacgcacaactgctg
cgccggatcgacctgagaccggaggccagtacccgcgcaattctcgaccggtag

DBGET integrated database retrieval system