KEGG   Mycobacterium sp. MCS: Mmcs_5437Help
Entry
Mmcs_5437         CDS       T00367                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mmc  Mycobacterium sp. MCS
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mmcs_5437
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mmcs_5437
   00650 Butanoate metabolism
    Mmcs_5437
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Mmcs_5437
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmcs_5437
   00622 Xylene degradation
    Mmcs_5437
   00621 Dioxin degradation
    Mmcs_5437
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mmcs_5437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
plasmid1:18249..19196
Genome map
AA seq 315 aa AA seqDB search
MSHSKVAVIGSGNIGTDLVVKLKKLATNVEIAVLVGIDPSSDGLARARRMGIGTVDTGVQ
GLIEHAEFDEIDIIFDSTSAKAHLVNEEALRTFGKRLIDLTPAAVGPYVVPAVNLDDHLG
APNVNMVTCGGQATIPIVAAISSVTAVHYAEIVASIASKSAGPGTRSNIDEFTQTTSAAI
EKVGGAAHGKAIIVLNPAEPPLIMRDTVLALVTDPDQNRIRQSVIDMVEKVSAYVPGYRL
KQEVQFTQLDDAESVATLTGGVDKGPGLWKVAVFLEVEGAAHYLPAYAGNLDIMTSAALQ
VAERIAANTVQEATR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagtcactccaaggtcgcagtcatcggttcgggcaacatcggtaccgacctagtcgtc
aaattgaagaagttggcgaccaacgtcgagatcgctgtgttggtcggcatcgacccgtcg
tcggatggtctggctcgtgcccgccggatgggtatcggcacagtcgacaccggtgtgcag
ggtttgatcgagcacgccgaattcgatgagatcgacatcatcttcgattccacgtcggcg
aaagcgcatctcgtcaacgaggaagcgttgcgtacctttggcaagcggctgatcgacctg
actcccgctgcagtcggtccctacgtcgtgcctgccgtgaatctcgacgaccacttgggt
gcgccgaacgtcaacatggtcacctgcggcggtcaggcgacgatccctatcgtcgcggcg
atctcatcggtcacggcggtgcactacgccgagatcgtcgcctcgatcgcgtcgaaatcg
gcgggtccgggaacacggtcgaatatcgatgaattcacccaaaccacctcagcggcaatc
gaaaaggtaggcggagcagcacacggcaaggcgatcatcgttctcaatcccgcggagcca
ccgttgatcatgcgcgataccgtcttggctctcgtgacggatcccgatcagaaccgcatc
aggcagtcggttatagacatggtggagaaggtgtcggcctacgtgccgggctaccgactc
aaacaggaagtgcagttcacccagctcgacgacgccgagtccgtcgcgaccctgaccgga
ggagtcgacaaggggcccgggctgtggaaggtggcggtcttcctagaagtcgagggtgcc
gcgcactacttgccggcctacgccggcaatctcgacatcatgacctcggcggcactacag
gtggccgagcggatcgcggcgaacactgtgcaggaggccacgcgatga

DBGET integrated database retrieval system