KEGG   Methanococcus maripaludis X1: GYY_00685Help
Entry
GYY_00685         CDS       T01584                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYY_00685
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYY_00685
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GYY_00685
Enzymes [BR:mmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GYY_00685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136424..137635
Genome map
AA seq 403 aa AA seqDB search
MIQKCRVCGKEYDVDAIIYNCECGGLLEIKYDFESIKEKVSKESLRERELGVWRYLDYLP
VKDPAKIVSLHEGGTPLYKCENLAKKLGMKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVEVVGCASTGNTSASLAAYSARAGKKCIVLLPGGKVALGKLAQAMFYGAKVIQINGNFD
EALVMVKNLALENKLYLLNSVNPFRLEGQKTIGFEICDQLDFEVPDMVILPVGNAGNISA
IWKGFKEFKETEMIDRLPKMTGIQAEGAQPIVKAIKEGLDEIVPDENPETIATAIRIGNP
VNAAKALDAIKSSGGLAESVNDEEIIEAQKLLAQTEGIFVEPASASSIAGLIKLINMGLI
DKDQKIVCITTGNGLKDPDAAIKASKMPTEIECDMEVLRKAIE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaatgcagagtatgcggaaaagaatacgatgttgatgccataatttacaac
tgcgaatgtggcggattactcgaaattaaatacgattttgaaagtatcaaagaaaaagtt
tcaaaagaatccttaagggaaagagaacttggtgtatggagatatttagactacttacca
gttaaagatcctgcaaaaattgtgagccttcacgaagggggaactccactttacaaatgt
gaaaatctcgcaaaaaaattaggaatgaaagagttatatgttaaaaacgaaggtgcaaac
ccaacaggaagtttcaaagatagagggatgactgttggagttacaagagcaaacgaactt
ggtgttgaagtagtaggctgtgcttcaaccggaaacacatctgcatcacttgcagcatac
tctgcaagagcaggtaaaaaatgtattgttcttcttcctggaggaaaagtagctcttgga
aaactcgctcaggcaatgttttacggtgcaaaagttatccagatcaacggaaactttgac
gaagctcttgtaatggttaaaaaccttgcattagaaaacaaactctacttattaaactct
gtaaacccattcagacttgaaggtcagaaaacaattggttttgaaatctgcgaccagtta
gactttgaagttccagacatggttattttaccggttggaaacgctggaaacatcagcgca
atctggaaaggatttaaagaatttaaagaaacagaaatgattgacagattaccaaaaatg
actggaatccaagcagaaggtgcacagccaattgtaaaagcgataaaagaaggactcgac
gaaatagttcctgacgaaaatcctgaaacaatcgcaactgcaatcagaatcggaaaccct
gtaaacgctgcaaaagcacttgatgcaatcaaatcttcaggagggcttgcagaaagcgta
aacgatgaagaaattatcgaagctcagaaactccttgcacaaacagaaggaattttcgta
gaacctgcttcagcttcatcaatcgcaggtcttatcaaattgataaacatgggattaatt
gacaaagatcaaaaaatcgtatgtattacaactggtaacggattaaaagatccagatgct
gcaatcaaagcaagtaaaatgcctacagaaattgaatgcgacatggaagtactcagaaaa
gcaatagaataa

DBGET integrated database retrieval system