KEGG   Methanococcus maripaludis X1: GYY_00755Help
Entry
GYY_00755         CDS       T01584                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmd  Methanococcus maripaludis X1
Pathway
mmd00010  Glycolysis / Gluconeogenesis
mmd00620  Pyruvate metabolism
mmd00640  Propanoate metabolism
mmd00680  Methane metabolism
mmd00720  Carbon fixation pathways in prokaryotes
mmd01100  Metabolic pathways
mmd01110  Biosynthesis of secondary metabolites
mmd01120  Microbial metabolism in diverse environments
mmd01130  Biosynthesis of antibiotics
mmd01200  Carbon metabolism
Module
mmd_M00357  Methanogenesis, acetate => methane
mmd_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYY_00755
   00620 Pyruvate metabolism
    GYY_00755
   00640 Propanoate metabolism
    GYY_00755
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    GYY_00755
   00680 Methane metabolism
    GYY_00755
Enzymes [BR:mmd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GYY_00755
Lipid biosynthesis proteins [BR:mmd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GYY_00755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEK19039
UniProt: G0H1N2
Position
152846..154756
Genome map
AA seq 636 aa AA seqDB search
MKTGDKYIMLEKYSELQQKALDDPEKFWGEQAKCLEWDKTWDKALDWNPPYAKWFKGGSL
NASYNCVDRHIKGNRRNKAAIICEKEDGSCGILTYYELYREVNKFANVLENLGVEKGDVV
TIYMPMMTEAIVAMLACSRIGAIHNVVFSGFSSDALADRINDSKSKILVTTNLLYRRGKE
IDLKKILDKALLNCNSIKHVVYAKRGSEDLNLVSGKDYYWDELMGGAKSYVEPVPVESEH
PLFILYTSGTTGSPKGVVHSTGGYLTYATKTMDWTWGLNEMDVFWCTADIGWITGHTYVV
YGPLSLGATIVLYEGAIDYPEPDRLWGIVENHGVTILYTAPTAIRMLMMYGEKWVNTHDL
STLRLLGSVGEPINPRAWKWYYKVIGKEKCPICDCYWQTETGGHIIYPPIGIQSVPLKPG
SATFPGIGIDVDVVDNEGNPVDANVKGNLIIKRPWPGMLAGLWNNDERYRAAYWDRFKNK
FSTSDYAIKDQDGYIWVLGRSDEVLNVSGHRIGTAELEHELVSNKMVAESAVVGKPDDVK
GEVPVAFVILNEKYRELPSNEVKAELIKHIRDTVGPIGTPAMIFFVNKLPKTRSGKIMRR
ILKKLIMGEEIGDVTTLEDNTSLEEVKKELEDFKYD
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactggagacaaatacataatgcttgaaaaatattcggaattacagcaaaaagct
ttggatgaccctgaaaaattctggggagagcaggctaaatgtttagaatgggataaaacc
tgggataaagcactggactggaatcctccttatgcaaaatggtttaaaggcggcagtttg
aatgcaagctacaactgtgttgataggcacataaaaggaaacaggagaaacaaagcagcc
ataatctgtgaaaaagaagacggcagttgcggaatactaacatattacgagttatatcgg
gaagtaaataaatttgcaaacgttctagagaatttgggcgttgaaaaaggcgatgttgtc
acaatctacatgccaatgatgacagaggcaattgttgcaatgctcgcatgttcgagaatt
ggggcaattcacaacgttgtattttccggattttcttcagatgcacttgctgatcggata
aacgattcaaaatcaaaaatattggtgactacgaaccttttatacaggcgtggaaaagag
attgaccttaaaaaaatattggataaagctttactgaattgtaattcaataaaacacgta
gtttatgcaaaaaggggaagtgaagacctcaatttagtttcaggaaaagattattactgg
gatgaattgatgggcggtgctaaaagttacgtagaacctgttcccgtagaatcagagcat
cctctatttatcctctacacgagcggtacaacaggaagtccaaaaggtgtagttcactca
acaggcggatatctaacttatgctacaaaaaccatggattggacatggggattaaatgaa
atggacgtattttggtgtactgcagacattggatggattacaggacacacttacgtagta
tatgggccgctttcactgggtgctacaatagtactctacgagggtgcaatagactaccct
gaacccgacagattgtggggcattgtagaaaatcacggagttacaattctatacactgca
ccaactgcgataagaatgctcatgatgtacggtgaaaaatgggtaaatactcatgattta
tcgacattgaggcttttaggaagcgttggggagccgataaatccaagagcttggaaatgg
tactacaaagtaattggaaaagaaaaatgcccgatctgcgactgctactggcaaactgaa
actggtgggcatattatatatcctccaattggaatccagtcagttccgttaaaaccaggt
tctgcaacattccctggaattggaattgatgttgatgttgtagacaatgaaggaaaccct
gttgacgcaaatgtaaaaggaaatctaattataaaacgaccatggccaggaatgcttgca
gggctctggaacaacgatgaaagataccgtgctgcatactgggataggttcaaaaacaaa
ttttcaacatctgactatgcaataaaagaccaggatggatacatttgggtactgggacga
tctgacgaagtattgaatgtttcaggacacaggattggaaccgcagaacttgaacacgaa
cttgtatcaaataaaatggttgcagagtctgccgtagttggaaaacccgatgatgtgaaa
ggagaagttcctgttgcatttgttatattaaacgaaaaataccgtgaacttccatcaaat
gaagtaaaggctgaacttatcaaacatattcgagatactgtcggcccaattggaactcct
gcaatgatattctttgtaaacaaacttccaaaaacaagaagtggaaaaataatgagaaga
atattgaaaaaacttataatgggtgaagagataggcgatgttaccacattggaagacaac
acaagtttagaagaagttaaaaaagagcttgaagatttcaagtatgattaa

DBGET integrated database retrieval system