KEGG   Methanococcus maripaludis X1: GYY_00755Help
Entry
GYY_00755         CDS       T01584                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYY_00755
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYY_00755
   00620 Pyruvate metabolism
    GYY_00755
   00640 Propanoate metabolism
    GYY_00755
  Energy metabolism
   00680 Methane metabolism
    GYY_00755
Enzymes [BR:mmd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GYY_00755
Lipid biosynthesis proteins [BR:mmd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GYY_00755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
152846..154756
Genome map
AA seq 636 aa AA seqDB search
MKTGDKYIMLEKYSELQQKALDDPEKFWGEQAKCLEWDKTWDKALDWNPPYAKWFKGGSL
NASYNCVDRHIKGNRRNKAAIICEKEDGSCGILTYYELYREVNKFANVLENLGVEKGDVV
TIYMPMMTEAIVAMLACSRIGAIHNVVFSGFSSDALADRINDSKSKILVTTNLLYRRGKE
IDLKKILDKALLNCNSIKHVVYAKRGSEDLNLVSGKDYYWDELMGGAKSYVEPVPVESEH
PLFILYTSGTTGSPKGVVHSTGGYLTYATKTMDWTWGLNEMDVFWCTADIGWITGHTYVV
YGPLSLGATIVLYEGAIDYPEPDRLWGIVENHGVTILYTAPTAIRMLMMYGEKWVNTHDL
STLRLLGSVGEPINPRAWKWYYKVIGKEKCPICDCYWQTETGGHIIYPPIGIQSVPLKPG
SATFPGIGIDVDVVDNEGNPVDANVKGNLIIKRPWPGMLAGLWNNDERYRAAYWDRFKNK
FSTSDYAIKDQDGYIWVLGRSDEVLNVSGHRIGTAELEHELVSNKMVAESAVVGKPDDVK
GEVPVAFVILNEKYRELPSNEVKAELIKHIRDTVGPIGTPAMIFFVNKLPKTRSGKIMRR
ILKKLIMGEEIGDVTTLEDNTSLEEVKKELEDFKYD
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactggagacaaatacataatgcttgaaaaatattcggaattacagcaaaaagct
ttggatgaccctgaaaaattctggggagagcaggctaaatgtttagaatgggataaaacc
tgggataaagcactggactggaatcctccttatgcaaaatggtttaaaggcggcagtttg
aatgcaagctacaactgtgttgataggcacataaaaggaaacaggagaaacaaagcagcc
ataatctgtgaaaaagaagacggcagttgcggaatactaacatattacgagttatatcgg
gaagtaaataaatttgcaaacgttctagagaatttgggcgttgaaaaaggcgatgttgtc
acaatctacatgccaatgatgacagaggcaattgttgcaatgctcgcatgttcgagaatt
ggggcaattcacaacgttgtattttccggattttcttcagatgcacttgctgatcggata
aacgattcaaaatcaaaaatattggtgactacgaaccttttatacaggcgtggaaaagag
attgaccttaaaaaaatattggataaagctttactgaattgtaattcaataaaacacgta
gtttatgcaaaaaggggaagtgaagacctcaatttagtttcaggaaaagattattactgg
gatgaattgatgggcggtgctaaaagttacgtagaacctgttcccgtagaatcagagcat
cctctatttatcctctacacgagcggtacaacaggaagtccaaaaggtgtagttcactca
acaggcggatatctaacttatgctacaaaaaccatggattggacatggggattaaatgaa
atggacgtattttggtgtactgcagacattggatggattacaggacacacttacgtagta
tatgggccgctttcactgggtgctacaatagtactctacgagggtgcaatagactaccct
gaacccgacagattgtggggcattgtagaaaatcacggagttacaattctatacactgca
ccaactgcgataagaatgctcatgatgtacggtgaaaaatgggtaaatactcatgattta
tcgacattgaggcttttaggaagcgttggggagccgataaatccaagagcttggaaatgg
tactacaaagtaattggaaaagaaaaatgcccgatctgcgactgctactggcaaactgaa
actggtgggcatattatatatcctccaattggaatccagtcagttccgttaaaaccaggt
tctgcaacattccctggaattggaattgatgttgatgttgtagacaatgaaggaaaccct
gttgacgcaaatgtaaaaggaaatctaattataaaacgaccatggccaggaatgcttgca
gggctctggaacaacgatgaaagataccgtgctgcatactgggataggttcaaaaacaaa
ttttcaacatctgactatgcaataaaagaccaggatggatacatttgggtactgggacga
tctgacgaagtattgaatgtttcaggacacaggattggaaccgcagaacttgaacacgaa
cttgtatcaaataaaatggttgcagagtctgccgtagttggaaaacccgatgatgtgaaa
ggagaagttcctgttgcatttgttatattaaacgaaaaataccgtgaacttccatcaaat
gaagtaaaggctgaacttatcaaacatattcgagatactgtcggcccaattggaactcct
gcaatgatattctttgtaaacaaacttccaaaaacaagaagtggaaaaataatgagaaga
atattgaaaaaacttataatgggtgaagagataggcgatgttaccacattggaagacaac
acaagtttagaagaagttaaaaaagagcttgaagatttcaagtatgattaa

DBGET integrated database retrieval system