KEGG   Methanococcus maripaludis X1: GYY_01500Help
Entry
GYY_01500         CDS       T01584                                 

Definition
(GenBank) aldolase
  KO
K16305  fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mmd  Methanococcus maripaludis X1
Pathway
mmd00010  Glycolysis / Gluconeogenesis
mmd00030  Pentose phosphate pathway
mmd00051  Fructose and mannose metabolism
mmd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmd00680  Methane metabolism
mmd01100  Metabolic pathways
mmd01110  Biosynthesis of secondary metabolites
mmd01120  Microbial metabolism in diverse environments
mmd01130  Biosynthesis of antibiotics
mmd01200  Carbon metabolism
mmd01230  Biosynthesis of amino acids
Module
mmd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYY_01500
   00030 Pentose phosphate pathway
    GYY_01500
   00051 Fructose and mannose metabolism
    GYY_01500
  Energy metabolism
   00680 Methane metabolism
    GYY_01500
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYY_01500
Enzymes [BR:mmd01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     GYY_01500
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     GYY_01500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: AEK19187
UniProt: G0H2A7
Position
complement(286857..287783)
Genome map
AA seq 308 aa AA seqDB search
MVKKITFEDVLIPMETPESMHEEYVQNYMKLTRNTGNLMLFAGDQKIEHLNNDFYGENIS
KDDADPEHLFKIAKNSKIGGFAVQFGLLSRYCRDYKDINYIVKLNSKTNLVDVDQKDPLS
LALLDINDILEFKKNSGVNIVGIGYTIYLGSEYESEMLSEASKIIYEAHKGGLVVILWIY
PRGKAVQNEKDPKLIAGATGVASCLGADFVKVNYPKSENPAESFKEAVMAAGKTKVVCAG
GSSTDIESFLKQLYEQIHISGASGNATGRNIHQKSLSDAVAMCNAIYAITIDGKTVSEAL
NIYSERKS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaaaaaataacctttgaagatgtattaattccgatggaaactccagaatcaatg
catgaagaatacgttcaaaattacatgaaacttacaagaaatactggcaatttaatgctt
tttgcaggcgatcaaaaaatcgaacatttaaataacgatttttacggggaaaatatttca
aaagacgatgcagatccagaacacctgtttaaaattgctaaaaattcaaaaataggcggt
tttgcagttcagtttggcttgttatcaagatactgtcgagattataaagatataaattac
attgtaaaattaaattcaaaaacaaatcttgtagatgtggaccaaaaagaccctttaagt
cttgcattattagatattaacgacatattggaatttaagaaaaattcaggagttaatatc
gttggaattggatatacaatatatcttggaagtgaatacgaatcagagatgctttctgaa
gcttcgaaaataatttatgaagcacataaaggaggacttgttgtaattctctggatttat
ccaagaggaaaagccgtgcaaaatgaaaaagaccctaaactgattgctggagctactggt
gttgcatcatgcttgggtgcagattttgtgaaagttaattatccaaaatcggaaaatcct
gcagaatcatttaaagaagctgttatggctgccggaaaaactaaagttgtatgtgcagga
ggatcaagtacagatattgaatcatttttaaaacaactttacgaacagattcacataagc
ggagcgtcaggaaatgcgacaggtcgaaatatccatcaaaaatcgttatctgatgcagtt
gcaatgtgtaatgcaatttatgcaataacaattgacggaaaaactgtttcagaagcttta
aatatatacagcgaaagaaaatcttaa

DBGET integrated database retrieval system