KEGG   Methanococcus maripaludis X1: GYY_01510Help
Entry
GYY_01510         CDS       T01584                                 

Definition
homoserine kinase (EC:2.7.1.39)
Orthology
K00872  
homoserine kinase [EC:2.7.1.39]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmd01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mmd00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288914..289819
Genome map
AA seq 301 aa AA seqDB search
MKKVKVCSPGTSANLGPGYDIFGLALSNPYDIVEVEKTENGITISVEGEKAEEIPTNVDE
NTAGVVAKKMIQDFKIESGIHIHIIKGIKPGSGLGSSSASCAGIAFALNELFELKLSKLE
LVKYSSLGEAVAAGAPHADNVAPAIFGGFTLTTSYEPLEVLHIPIDLEVLVALPNIQVST
KTAREILPKEIPIKDMVNNVGKAAGMVYALYNNDLDLFGRYMSKDCVVEPCRANLIDGYA
EVKEKVKDMVYGITISGSGPAIITIPKKEHVIDIENIFKEVWNCPVYYTKVGPGCYVEEI
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaaaggtatgttctccgggaacttctgcaaatctcggtccaggatacgat
atttttgggcttgctctttcaaatccttatgatattgtagaggttgaaaaaacagaaaat
ggtatcactatatctgttgaaggggaaaaagcagaagaaatacctacaaacgtagatgaa
aatactgcaggcgtagttgctaaaaagatgattcaagattttaaaatcgaatctggaatt
catattcatataattaaaggaataaagccaggaagtggtcttggaagcagttctgcctca
tgtgcaggaattgcttttgcgttaaatgaactttttgaactaaaattatccaaattagag
ctagttaaatattcttcacttggggaagcagttgcagcaggtgctcctcacgcagataac
gtagctccagcaatttttggtggatttactcttacaacaagttatgaacctttagaggta
cttcatattccaatagatcttgaagttttggttgcacttccaaatattcaggtaagtaca
aaaaccgcaagagaaatacttccaaaagaaatcccgataaaagatatggtaaacaatgtt
ggaaaagctgcaggaatggtttatgcattatataacaacgatctagatctttttggaaga
tacatgtcaaaagactgcgttgttgagccatgcagggccaatttaattgatggatatgcg
gaagttaaagaaaaagtaaaagacatggtctatggtataacgattagtggttcaggacct
gcaattattacaatacctaaaaaagaacacgtaattgatatcgaaaatatatttaaggaa
gtctggaactgcccagtttactacacgaaagtggggcccggatgttacgttgaagaaatt
gaataa

DBGET integrated database retrieval system