KEGG   Methanococcus maripaludis X1: GYY_01510Help
Entry
GYY_01510         CDS       T01584                                 

Definition
homoserine kinase (EC:2.7.1.39)
Orthology
K00872  
homoserine kinase [EC:2.7.1.39]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYY_01510
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYY_01510
Enzymes [BR:mmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     GYY_01510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288914..289819
Genome map
AA seq 301 aa AA seqDB search
MKKVKVCSPGTSANLGPGYDIFGLALSNPYDIVEVEKTENGITISVEGEKAEEIPTNVDE
NTAGVVAKKMIQDFKIESGIHIHIIKGIKPGSGLGSSSASCAGIAFALNELFELKLSKLE
LVKYSSLGEAVAAGAPHADNVAPAIFGGFTLTTSYEPLEVLHIPIDLEVLVALPNIQVST
KTAREILPKEIPIKDMVNNVGKAAGMVYALYNNDLDLFGRYMSKDCVVEPCRANLIDGYA
EVKEKVKDMVYGITISGSGPAIITIPKKEHVIDIENIFKEVWNCPVYYTKVGPGCYVEEI
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaaaggtatgttctccgggaacttctgcaaatctcggtccaggatacgat
atttttgggcttgctctttcaaatccttatgatattgtagaggttgaaaaaacagaaaat
ggtatcactatatctgttgaaggggaaaaagcagaagaaatacctacaaacgtagatgaa
aatactgcaggcgtagttgctaaaaagatgattcaagattttaaaatcgaatctggaatt
catattcatataattaaaggaataaagccaggaagtggtcttggaagcagttctgcctca
tgtgcaggaattgcttttgcgttaaatgaactttttgaactaaaattatccaaattagag
ctagttaaatattcttcacttggggaagcagttgcagcaggtgctcctcacgcagataac
gtagctccagcaatttttggtggatttactcttacaacaagttatgaacctttagaggta
cttcatattccaatagatcttgaagttttggttgcacttccaaatattcaggtaagtaca
aaaaccgcaagagaaatacttccaaaagaaatcccgataaaagatatggtaaacaatgtt
ggaaaagctgcaggaatggtttatgcattatataacaacgatctagatctttttggaaga
tacatgtcaaaagactgcgttgttgagccatgcagggccaatttaattgatggatatgcg
gaagttaaagaaaaagtaaaagacatggtctatggtataacgattagtggttcaggacct
gcaattattacaatacctaaaaaagaacacgtaattgatatcgaaaatatatttaaggaa
gtctggaactgcccagtttactacacgaaagtggggcccggatgttacgttgaagaaatt
gaataa

DBGET integrated database retrieval system