KEGG   Methanococcus maripaludis X1: GYY_01630Help
Entry
GYY_01630         CDS       T01584                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mmd  Methanococcus maripaludis X1
Pathway
mmd00010  Glycolysis / Gluconeogenesis
mmd00030  Pentose phosphate pathway
mmd00051  Fructose and mannose metabolism
mmd00680  Methane metabolism
mmd01100  Metabolic pathways
mmd01110  Biosynthesis of secondary metabolites
mmd01120  Microbial metabolism in diverse environments
mmd01130  Biosynthesis of antibiotics
mmd01200  Carbon metabolism
mmd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYY_01630
   00030 Pentose phosphate pathway
    GYY_01630
   00051 Fructose and mannose metabolism
    GYY_01630
  Energy metabolism
   00680 Methane metabolism
    GYY_01630
Enzymes [BR:mmd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     GYY_01630
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     GYY_01630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AEK19213
UniProt: G0H2L4
Position
306593..307744
Genome map
AA seq 383 aa AA seqDB search
MEEKVTLSVIKADVGGLCGHTLAPEELLDAAEYVLENALDETLIDYYVTNCGDDIDMIMT
HDKGTDNEEVHKLAWDALEAATEVAKELKLYGAGQDLLSNSFSGNVKGLGPGCAEMEFVE
RPSEPVVVFCCDKTDPAAFNLPFYKMFADPFSTAGLVYDPSMTSGFRYEILDVFAHKRVF
LDAPEEMYSLLALIGNTEKYAVKRVYRRKDNEIAAVCSSEKLNMIAGEYVGKDDPVAIVR
AQSGFPAVGEVLEGFANPHLVAGWMRGCHFGPIMPVAEEDAMPARFDGPARVMALGFQLS
KGRLVGPNDLFADKSFDKAREKALDMAEMMRSMGPFMPHRLPESMMEYTSVPKVLAQLKD
RFLEMDEGCECKLDEIRERGDME
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaagtaaccttaagtgttattaaggcagatgttggagggctttgtggacac
acattagctccagaagaattattagacgctgcagagtatgttctcgaaaatgcgctcgat
gaaacattaattgattattatgttacaaactgtggtgacgatatcgacatgatcatgacc
cacgataagggaacagacaacgaagaagtacacaaacttgcatgggacgctcttgaagca
gcaacagaagttgcaaaagagttaaaattatacggtgcaggacaagacttactttcaaac
tcattttccggaaacgttaaaggactcggtccaggctgcgcagaaatggaatttgttgaa
agaccaagtgaaccagttgtagttttctgctgtgacaaaacagaccctgcagcattcaat
ttaccattctataaaatgtttgcagacccattcagcactgcaggattggtatacgaccct
tcaatgacctcaggattcagatacgaaattttagatgtttttgcacacaaaagagtattt
ttagatgctcctgaagaaatgtactcattacttgcattaattggaaacactgaaaaatac
gctgtaaaaagagtttacagaagaaaagacaacgaaattgcagcagtatgttcatcagaa
aaattaaacatgattgctggagaatacgttggaaaagacgatccagtagcaattgtaaga
gctcaaagtggattccctgcagtaggggaagttttagaaggatttgcaaacccacacctc
gttgcaggatggatgagaggatgccactttggacctatcatgccagttgctgaagaagat
gcaatgcctgcaagatttgacggtcctgcaagagttatggctttaggattccagttatca
aaaggaagattagttggaccaaacgacctctttgcagacaaatcattcgataaagcaaga
gaaaaagcacttgatatggctgaaatgatgagatcaatgggtccattcatgccacacaga
ttacctgaatcaatgatggaatacacatcagttccaaaagttttagctcaattaaaagac
agattcctcgaaatggacgaaggatgcgaatgcaaactcgatgaaataagagaaagagga
gacatggaataa

DBGET integrated database retrieval system