KEGG   Methanococcus maripaludis X1: GYY_01675Help
Entry
GYY_01675         CDS       T01584                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mmd  Methanococcus maripaludis X1
Pathway
mmd00010  Glycolysis / Gluconeogenesis
mmd01100  Metabolic pathways
mmd01110  Biosynthesis of secondary metabolites
mmd01120  Microbial metabolism in diverse environments
mmd01130  Biosynthesis of antibiotics
mmd01200  Carbon metabolism
mmd01230  Biosynthesis of amino acids
Module
mmd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmd_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYY_01675
Enzymes [BR:mmd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     GYY_01675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N Sacchrp_dh_NADP 2-Hacid_dh_C TrkA_N NAD_binding_3 CoA_binding Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AEK19222
UniProt: G0H2M3
Position
complement(315714..316736)
Genome map
AA seq 340 aa AA seqDB search
MANVLINGYGSIGKRVADAVAKQDDMKVIGVTKTKPDFEAKMAVEKGYKLFAAIPERKHL
FEEAGIPVEGTLDDIIEDADIVVDGAPKKIGKANLENVYKKHGVKAIIQGGEKAGDAQDS
FNSLWSYDRCYGKDYIRLVSCNTTGLCRSMYAINSVADILKARIVLIRRAADPNDIKTGP
VNAIVPNPVSVPSHHGPDVVSVIPELDGKIMTSAVIVPTTLMHMHSIMVETSGTNRDEII
DALAKTPRILTVKASEGFDSTAKIIEYARDLGRSRYDLNEIAVWEESVNVVDNEVYMMQA
IHQESDVIPENVDCIRAMLEMESDNLKSIEKTNKALGLIK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtattgataaacggttacggctctatcggtaaaagggttgccgatgcagta
gctaaacaggacgatatgaaagttattggagttacaaaaacgaaacctgactttgaagct
aaaatggctgttgaaaaaggatacaaattatttgcagcaattcctgaaagaaaacatctt
tttgaagaagcaggaattcctgttgaaggaacacttgacgacattattgaagatgcagat
attgtagttgacggagcccctaaaaaaattggaaaagcaaatctcgaaaacgtatacaaa
aaacacggcgtaaaagcaataatccaaggtggagaaaaagcaggcgacgcacaagactca
tttaactcactatggagttacgacagatgctacggaaaagactacatcagactcgtatca
tgcaacacgacaggactttgtagatcaatgtacgcaattaattcagttgcagacatttta
aaagcaagaatagtcttaataagaagagctgctgaccctaacgacataaaaacaggacca
gtgaatgcaatcgttccaaatccagtatcagttccatcacaccacggaccagacgttgtt
tcagttattcccgaactcgatggaaaaatcatgacttcagcagttatcgttccaacaacc
ttgatgcacatgcactcaataatggtagaaacttctggaacgaatagagatgaaataata
gatgcacttgcaaaaacaccaagaatattaaccgtaaaagcttcagaaggatttgattca
actgcaaaaattattgaatatgcaagagaccttggaagaagcagatacgatctaaatgaa
attgcagtatgggaagaaagcgtaaacgttgtagacaatgaagtatacatgatgcaggca
atacaccaggaaagcgatgttatccctgaaaacgtggactgtatccgagcaatgctcgaa
atggaaagcgacaacttaaaatcaattgaaaaaaccaataaagcgctaggtttaattaaa
taa

DBGET integrated database retrieval system