KEGG   Methanococcus maripaludis X1: GYY_01685Help
Entry
GYY_01685         CDS       T01584                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mmd00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
319081..320598
Genome map
AA seq 505 aa AA seqDB search
MLFLNAKFIDLDLGENAVIVNEEDLKGTSYYPQDRVLIESHAGSVIGNIYSTKTMVQKGE
VGMLVSELAEISISEGEEVKLRHAEKPESIPFIKKKMDGQVLNPHEIRTIIDEIVSKKLS
NIELSAFVSSTYINGMNMDEIGEMTKRIAETGDMISWEKNLVVDIHSIGGVPGNKYALLS
IPILAAAGITIPKTSSRAITSPAGTADVMEVLTNVELKEDEIKRIVKTTNGCLVWGGGVN
LAPADDIIINVERPVSIDPQPQLLASVMAKKIATGIKYTVIDIPVGKGVKIKNEAEGAKL
ARKFIELGELLNIKVECVLTYGGQPLGRAIGPALEAKEAIEALQDPKNAPKSLIEKALSL
AGILLELGGAAQIGEGQNLAWEILESGRALEKFNQIIIEQGGTPKKPEEIELGDYIEEII
APIDGYVTDINNTGITNVVKEAGAPRDKKAGLLLNSKIGNKVKKGDVLYTIYSGSEERLV
SAVNLARRVYPVKVEGMLIERISKF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctatttttaaatgcaaaatttatagaccttgatctgggcgaaaatgcggtaattgtt
aacgaagaagatttaaaaggaacttcttactacccgcaggatagggtattgatagagtca
cacgcaggttctgtcattggaaatatttattctacgaaaacaatggtccaaaaaggcgaa
gttggaatgcttgtcagtgaacttgcagaaatttcaatttcagaaggagaagaagtaaaa
ttaaggcatgcagaaaagcctgaatcgattccgtttataaaaaagaaaatggatggacaa
gttctaaatcctcacgaaataagaacgataatcgatgaaatcgtatctaaaaaactctca
aacattgaattatccgcatttgtttcatctacgtatattaatggaatgaatatggatgaa
ataggtgagatgaccaagaggattgcagaaacaggggacatgatttcttgggagaaaaat
cttgttgtcgatattcacagtattggcggagttccgggaaataaatacgctctgctttca
attccaatacttgcagcagcaggaatcacaattccaaaaacctcatcaagggcgataact
tcgcctgcaggaactgccgatgtaatggaagtgctcacaaatgttgaattaaaggaagac
gagataaaaagaatagtaaaaaccacaaatggatgtcttgtatggggcgggggggtaaat
ttagcacctgctgacgatattatcatcaatgtggaaagacctgtttcaatagaccctcag
ccacagcttcttgcaagtgttatggcaaaaaagattgcaacaggaattaaatatactgta
attgatattcctgttggaaaaggagtaaaaattaaaaatgaagcagaaggggcaaaatta
gcgaggaaatttattgaacttggggaattgctcaacattaaagtagagtgtgtcttaact
tatggtggacagcctcttggaagggcaattgggccagcactcgaagcaaaagaagcaatc
gaagcacttcaagatcccaaaaatgctccaaaaagtttaattgaaaaagccttatctctt
gcaggtatcctccttgaacttgggggagctgcacagattggcgaagggcagaacttagca
tgggaaattttagagtctggtagggcacttgaaaaattcaaccagatcataattgaacag
ggcggaactccaaaaaaacctgaagaaatagaacttggagactatattgaagaaataatt
gctccaatagatggctacgttacagatataaataatactggaattacaaacgtagttaaa
gaggctggagctccaagggataaaaaagcaggacttttactaaactcaaagattggaaac
aaagttaaaaaaggagatgtgttgtataccatctattctggctctgaagaaaggcttgta
tcagcagtaaatcttgcaagaagagtttatcctgtaaaagttgaaggaatgcttattgaa
agaataagtaaattctaa

DBGET integrated database retrieval system