KEGG   Methanococcus maripaludis X1: GYY_02830Help
Entry
GYY_02830         CDS       T01584                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmd  Methanococcus maripaludis X1
Pathway
mmd00010  Glycolysis / Gluconeogenesis
mmd00051  Fructose and mannose metabolism
mmd01100  Metabolic pathways
mmd01110  Biosynthesis of secondary metabolites
mmd01120  Microbial metabolism in diverse environments
mmd01130  Biosynthesis of antibiotics
mmd01200  Carbon metabolism
mmd01230  Biosynthesis of amino acids
Module
mmd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmd_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYY_02830
   00051 Fructose and mannose metabolism
    GYY_02830
   00562 Inositol phosphate metabolism
    GYY_02830
Enzymes [BR:mmd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GYY_02830
Exosome [BR:mmd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GYY_02830
  Exosomal proteins of bladder cancer cells
   GYY_02830
  Exosomal proteins of melanoma cells
   GYY_02830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh His_biosynth IGPS NMO
Motif
Other DBs
NCBI-ProteinID: AEK19445
UniProt: G0H3X9
Position
complement(534818..535339)
Genome map
AA seq 173 aa AA seqDB search
MILDEVNIPVYAQHMDAVNPGSSTGHILPDALKDAGVTGTLLNHSERRMLLADLEKCIEI
SNKLGLKTVVCTNNITVSKAVSALNPTSIAVEPPELIGSGIPVSKANPEVVSGTVREVRE
INKNVEILCGAGISKGEDVKSALELGTNGVLLASGVVKAKNVEDAIRELIAEI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaagtaaatattcctgtttatgcacaacacatggatgcggtaaatcct
ggaagcagtactggacacatactgcctgatgcattaaaagatgcaggagttacaggaact
cttttaaaccactctgaaagaagaatgcttcttgcagaccttgaaaaatgcatcgaaatt
tcaaataaactcggattaaaaactgttgtatgtacaaacaatataactgtttcaaaagca
gtttctgcgttaaatccaacttcaattgcagtagaacctccagaattgattggaagcgga
ataccagtttcaaaagcaaatcctgaagtagtatcaggaactgttagggaagttcgagaa
attaacaaaaacgttgaaatattgtgcggtgcaggtatctcaaaaggggaagatgtaaaa
tctgcgcttgaacttggaacaaacggtgttttgctcgcatcaggtgttgtaaaagctaaa
aacgtcgaagatgcaataagagaattgattgcagaaatttaa

DBGET integrated database retrieval system