KEGG   Methanococcus maripaludis X1: GYY_04145Help
Entry
GYY_04145         CDS       T01584                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GYY_04145
Enzymes [BR:mmd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     GYY_04145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
774218..775300
Genome map
AA seq 360 aa AA seqDB search
MSRKVVYPFGAIVGQEKAKKALLCCAVDPSIGGVLLTGDKGAGKSTLVRSLSHVLPNFEA
VLECPFNCNPENPLEMCDNCYENANSANEFKKLEKTMKVVDLPLSVTIDRLVGTIDIKKA
LNEGKRVLQPGILANANRNILYIDEVNLLDDYVIDILLDSAAMGWNTIEREGISFKHPSR
FVLIGSMNPEEGELRPQLLDRFGLYVEIESLFEAEDRLEVLKRVEKFQKDPFSFYETYAS
IEENLTESIKTAKKILNDVTISEELLKMLIDSIIHLGIKTHRAEITTIKTAKTIAALDGR
MEVSLEDLKTAMDLALIHRLSNPNSNPPSQSMENENNEEMEDESKKKRKQIRQLVPHHHH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaaagtagtatatccttttggagcaattgtcggtcaagaaaaagcaaaaaaa
gcactactttgttgtgcagttgatccgtcaattggtggagtgctattaactggcgataaa
ggtgctggaaaatcgacacttgtaaggtcactttcacatgttttaccaaattttgaagct
gttttggaatgcccatttaattgcaatcctgaaaaccctcttgaaatgtgcgataactgt
tacgaaaatgcaaattcggccaatgagtttaaaaaacttgaaaaaactatgaaagtagtt
gatttaccattaagtgtaactattgataggcttgttggaacgatagatatcaaaaaagca
cttaatgaaggaaaaagagttcttcaacccggaattttggccaacgcaaatcgaaatata
ctttatattgatgaagtgaatttactcgatgattatgttattgatatattgctcgattct
gcagcaatgggttggaatacgattgaaagagagggaatttcctttaaacacccttcaaga
tttgtgctaattggaagtatgaatccagaagaaggtgagttaagaccccagttacttgat
agattcggactttacgtggaaatagaatccctctttgaagcagaagatcggcttgaagtt
ttaaaaagagtcgaaaaattccaaaaagacccattttcattttatgaaacgtatgcgtca
atcgaagaaaatttaacagaatcgataaaaactgcgaaaaaaattctgaatgacgtaaca
atttcagaagaactattaaaaatgttaattgattccataattcatttaggaataaaaacg
catcgtgcagaaataaccacgataaaaactgcgaaaaccattgcagcacttgatggacgt
atggaagttagtttggaggatttaaaaacagcgatggatcttgcactcattcacagatta
tctaatccaaacagtaatccgccatcacagtccatggaaaatgaaaataacgaagaaatg
gaagacgaatctaaaaaaaaacggaaacagatccgccaactagtcccccatcaccaccat
tag

DBGET integrated database retrieval system