KEGG   Methanococcus maripaludis X1: GYY_05350Help
Entry
GYY_05350         CDS       T01584                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mmd02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mmd02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
989101..990198
Genome map
AA seq 365 aa AA seqDB search
MSKIKVLIVDDSAFMRKVLEDILKSDDEIEVVATAKDGKEAFELVKKLEPNVITMDVEMP
IMNGIDATKQIMAYKPTPILMLSAVTKQGSEATLKALDNGAVDFIEKPSGSVSLDIRKIG
EKIIKQVKDASKSKVRIKSSRILETIKKEKQEESSTPKPQVEKTSGLSPEKLNDTAILIG
SSTGGPPVVSGIISNIPKNTPPIFIVQHMPKGFTRVFAERMNNNSAITVKEAEHGEIVKP
DHAYVAPGDSQMILQKRGGNVYIIIDENMPKIHGTKPTVDVTAEYVTKYYGKNTIGVLLT
GIGRDGANGLKMVKNKGGYTIAQNQDTCVIYGMPKTAVEMNVVDKVMDPIDIPLEIIKFA
KKIGG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaataaaggttctaattgtagatgattcagcatttatgaggaaggttttagaa
gatattttaaaatccgatgacgaaatagaagttgttgctactgcaaaagatggaaaggaa
gcattcgagcttgtaaaaaaattagaaccaaatgtaattaccatggatgttgaaatgccg
atcatgaatggaattgacgctacaaagcagatcatggcatacaaacctactcccatactc
atgctttccgcagtaacaaaacagggctcagaagctacattaaaagcactggataatggc
gcagttgattttatagaaaagccatcgggttctgtttcactggacattagaaaaatcggg
gaaaaaataattaaacaggttaaagatgcttcaaaatctaaagtaagaattaaatcatcc
cgaattttagaaactattaaaaaagaaaaacaggaggaaagcagtactccaaaaccgcag
gttgaaaaaacttctggactttctcctgaaaaattaaatgatactgcaatattaataggc
tcttcaacaggcgggccaccagtggtttcaggcataatttcgaatattcctaaaaacaca
cctccaatttttatagttcaacacatgcctaaaggatttacccgtgtttttgctgaaagg
atgaacaataattctgcaattactgttaaagaagcagaacatggtgaaattgtaaaaccc
gaccatgcctacgttgcacccggcgactctcaaatgattcttcaaaaaagaggtggcaat
gtatacatcataattgatgaaaatatgccaaaaatccacggaacgaaaccaactgtggat
gtaactgccgaatacgtcacaaaatattatggaaaaaacacaattggcgtacttttaaca
ggtatcggaagagatggtgcaaacgggctaaaaatggtaaaaaataagggcggatataca
attgcacaaaatcaggacacttgtgttatttacggcatgcctaaaacggcagttgaaatg
aatgtagtcgataaagtgatggatccaatagatattcctttagaaatcattaaattcgcc
aaaaaaatagggggctga

DBGET integrated database retrieval system