KEGG   Methanococcus maripaludis X1: GYY_05665Help
Entry
GYY_05665         CDS       T01584                                 

Gene name
hisD
Definition
(GenBank) bifunctional histidinal dehydrogenase/histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mmd  Methanococcus maripaludis X1
Pathway
mmd00340  Histidine metabolism
mmd01100  Metabolic pathways
mmd01110  Biosynthesis of secondary metabolites
mmd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    GYY_05665 (hisD)
Enzymes [BR:mmd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     GYY_05665 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh HutP Pox_P4A
Motif
Other DBs
NCBI-ProteinID: AEK19998
UniProt: G0H0B7
Position
1048685..1049959
Genome map
AA seq 424 aa AA seqDB search
MIVKKISKLNEKELDIIINRNKTNISGILPTVSEILENVQKNGDNALKEYTKKFDGVDID
NFKVSSEEIDKAYDKIDSKVVESLEKAYENIREFHEIQFKNLNEWEIDKKGIKAGQIIRP
VEKAGCYVPGGRAFYPSTVLMTVTPAKVAGVKEVIVTSPPNGTEGNPATLVASDIAKADG
IYKIGGAQAIGALAYGTKSIPKVDIIVGPGNIFVTAAKKLVYGEVSIDFPAGPSEVLIMC
DESSNEEYVAMDFLAQAEHDPNASCIITVTSEEKAEKIKERILMEIKTAKRTEIIEKSIL
NSAIVTGSIEECIELSNSYAPEHLEIMTKNPREVLKSIENAGSIFLGNYAPVPVGDYASG
TNHVLPTSACAKMYSGLSVETFIKKPTVQELTKEGLLGISDIVTTLAEAEGLFNHSEAVK
RRLN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcaaaaaaatatcaaaattaaacgaaaaagaacttgatattataattaacagg
aataaaacaaacatttctggaattttaccgacagtaagcgaaattttagaaaatgttcaa
aaaaatggagataatgccttaaaagaatatactaaaaaattcgatggcgtagatattgat
aattttaaggtatcttctgaagaaattgataaagcatacgacaaaatcgattcaaaagta
gttgaatctctcgaaaaagcttacgaaaacattagagagtttcacgaaatccagtttaaa
aatttaaacgaatgggaaattgataaaaaaggaattaaagcgggacaaattataaggcct
gttgaaaaagctggatgttacgttccaggaggacgggcattttacccttcaacagttcta
atgactgtgactcctgcaaaagtagcaggtgtaaaagaagtaattgtaacatcccctcca
aacggaaccgaaggaaaccctgcaacacttgttgcctcagacattgcaaaggctgacgga
atatataaaattggaggagcgcaagccattggagctcttgcatacggcactaaatctatt
ccaaaagtcgatattattgttggacctggaaatatctttgtaactgccgctaaaaagtta
gtttacggcgaagtttcaattgattttccagcagggccttccgaagttcttattatgtgt
gatgaatcatcaaatgaagaatacgttgcaatggactttttagcacaggctgagcacgac
cctaacgcttcatgtataattacagtcacttccgaagaaaaagcagaaaaaattaaagaa
agaattttgatggaaataaaaactgctaaaagaaccgaaattattgaaaaatcgatttta
aattctgcaattgttaccggctcaattgaagagtgtattgaactttcaaacagctacgcg
ccagaacacttagaaataatgacgaaaaatcctagagaagtactaaaatccattgaaaat
gctggaagcatctttttaggaaattacgcacctgttcctgttggggactatgcaagcggt
acaaaccacgttcttccaacctctgcttgtgcaaaaatgtattctggactcagcgttgaa
acatttattaaaaagccaacagttcaagaattgacaaaagaaggacttttaggaattagt
gacattgtaactacacttgcagaagctgaaggattatttaaccattctgaagcagttaaa
agaagattaaattaa

DBGET integrated database retrieval system