KEGG   Methanococcus maripaludis X1: GYY_05840Help
Entry
GYY_05840         CDS       T01584                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYY_05840 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYY_05840 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYY_05840 (trpA)
Enzymes [BR:mmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GYY_05840 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1080668..1081444)
Genome map
AA seq 258 aa AA seqDB search
MNKPVLVSFLVSGDPNPDATLKFMKTLDKYSGVIELGIPFSDPVADGPTIQAADVRSLSN
NFKIAKSFEVLKEFRKESDTPVILMTYYNPVYKRGIENFVIQAKEAGANGLIIVDLPLQE
ATEYREICKKHEMGTVFLAAPNTPEERLKISDEASTEFLYLISTFGITGARDTFEQMTFD
FIKRARTTCKGKICVGFGISKGSHAESLIEQGADGVIVGSAFVDIIKNYGDSKEALVKLE
ELAKELSEGIEKGYEKRK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccagtgttagtcagttttttagtttcgggagacccaaatccggatgcaaca
ttgaaatttatgaaaacactcgataaatattcgggagtaatcgaacttggaattccattt
agtgatcctgttgcagatgggccaactattcaggcagcagatgtaaggtccttatcaaac
aattttaaaattgcaaaatcatttgaagtattgaaagaatttagaaaagagtcagatact
cctgtaattttgatgacttactacaacccagtttacaaaagaggaattgaaaactttgta
attcaggcaaaagaagcaggtgcaaacgggcttattattgttgatttgccactccaagaa
gcaacggaatatcgagaaatctgtaaaaaacatgaaatgggaacggtatttcttgcagca
ccaaacactccagaagaacgtttaaaaatatctgatgaagcaagtactgaatttttgtac
cttatttcaacttttggaataactggtgcaagagatacatttgaacagatgacatttgat
tttattaaacgagcaagaacaacctgtaagggaaaaatctgcgttggatttggaatttca
aaaggaagtcatgcagaaagtttaattgaacagggtgctgacggagtaattgttggaagt
gcgtttgtagatattattaaaaattacggggattcaaaagaagcacttgttaaattagaa
gaacttgcaaaagaattaagtgaaggaatcgaaaaaggatacgaaaaaagaaaataa

DBGET integrated database retrieval system