KEGG   Methanococcus maripaludis X1: GYY_05845Help
Entry
GYY_05845         CDS       T01584                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYY_05845
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GYY_05845
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GYY_05845
Enzymes [BR:mmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GYY_05845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1081445..1082629)
Genome map
AA seq 394 aa AA seqDB search
MKCEGYFGEYGGQFIPEVLMPAIDELKEAYFELKDDEDFQNELSYYLKNYAGRETPLYYA
ENLTKKLGGAKIYLKREDLLHGGAHKTNNTIGQALLAKKMGKTRIIAETGAGQHGVGTSM
AGALFGLETEIFMGRLDTERQQPNVFRMKLLGAKVTPVDTGSKVLKDAVNEAMRNWTATF
ENTHYLIGTVMGPHPFPTIVRDFQSVIGKEVKKQIMEQEGRLPDHLVACIGGGSNALGLF
HAFIHDKDVRMVGIEAAGKGLNTSLHGASISKGKKGVLHGMLSYFLQDEDGQIEEAYSIS
AGLDYPGIGPEHAYLHDSGRAEYASATDDQALSAFMELTRSEGIIPALESSHAVAYAIEN
AGNMDKDEIMVINLSGRGDKDLNTVIDIMQKRGM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtgaaggatactttggagaatacggtgggcagtttatccctgaagttttgatg
cctgcaattgacgagcttaaagaagcttattttgaattgaaagatgatgaagactttcaa
aacgagctttcttactatttaaaaaattatgcagggcgtgaaacaccactctactatgct
gaaaatttgactaagaagcttggcggtgcaaaaatctacttaaaaagagaagatttactt
cacggcggagctcacaaaactaacaacacaatcggtcaggcattgcttgctaaaaaaatg
ggtaaaacaagaataattgcagaaactggtgcaggtcaacacggtgttggaacttcaatg
gctggagctttatttggacttgaaactgaaattttcatgggaaggctcgatacagaaaga
cagcaaccaaacgtatttagaatgaaacttcttggagcaaaggttacccctgtcgatact
ggttcaaaagttttaaaagatgcagtaaacgaagcaatgagaaactggactgcaactttt
gaaaacacgcactatttaattggaactgtgatgggaccacacccattcccaacaattgtt
agggattttcagtcagtaattggaaaagaagttaaaaaacaaattatggaacaggaagga
agactcccagaccacttagttgcatgcattggtggtggaagcaacgcacttggtttattc
catgcatttattcatgataaagatgttagaatggttggaatcgaagctgcaggaaaagga
ctcaatacgagccttcacggagcatccatttcaaaaggaaagaaaggagttcttcacgga
atgctttcatacttcttacaggacgaagatggccaaattgaagaagcttacagtatttcc
gcaggacttgattatcctggaatcggtccagaacacgcatatttacacgattctggaaga
gcagaatatgcatcagcaactgatgatcaggcattaagcgcatttatggaacttacgaga
agtgaaggtataattccagctttagaatcttcacacgcggtagcttatgcgattgaaaat
gcaggaaacatggataaagatgaaataatggtcataaacctttcaggaaggggcgacaag
gatttaaacaccgtaatcgacatcatgcaaaaaagagggatgtaa

DBGET integrated database retrieval system