KEGG   Methanococcus maripaludis X1: GYY_06275Help
Entry
GYY_06275         CDS       T01584                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GYY_06275
   00052 Galactose metabolism
    GYY_06275
   00500 Starch and sucrose metabolism
    GYY_06275
   00520 Amino sugar and nucleotide sugar metabolism
    GYY_06275
Enzymes [BR:mmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GYY_06275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1172226..1173074)
Genome map
AA seq 282 aa AA seqDB search
MIKKAIIPAAGFGTRLLPITKAQPKEMLPVLGKPIIQYVIEDLANAGIEDILVITGRGKY
AIENHFDKNFELEERLKKDGKCEPLKKILDINEFANIYYTRQGKQNGLGDAVHCGKEFIC
EDYTIVMVGDTIYSGNVPKKLLEAHEKYGCSVIALERVPKEDVYKYGVISGKELENGIFE
IDDLVEKPSVEDAPSNLIITGAYLLSSKIFDHIENTKPGRGGEIQLTDAMKSLLKEEKII
GVEVDFKRYDIGDIKGWLEANVELGIENIDGFKEYIRELCDK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagctatcatacctgcagcaggatttggaacaaggcttcttccaattaca
aaagcacagccaaaagagatgttgccagtacttggaaaaccaattatacagtatgtaatt
gaagatttggcaaatgctggaattgaggatattttggtaattacgggccgtggaaaatac
gcaatagaaaaccacttcgataaaaattttgaacttgaagagcggttaaaaaaagatgga
aaatgcgaacctctaaaaaaaatattagatattaatgaatttgcaaatatatattataca
aggcagggaaaacaaaatggccttggagatgcagtgcattgtggaaaagagtttatttgt
gaagattatacaattgtaatggttggggacaccatttattctggaaatgtgccaaaaaaa
ctccttgaagcacatgaaaaatatggatgttctgtaattgcacttgaacgagttccaaaa
gaagatgtttataaatacggagtaatttctggaaaagaactcgaaaatggaatttttgaa
atagatgatcttgtggaaaagccaagtgtagaagacgctccatccaatttgataattacg
ggagcttatttactgtcttcaaaaatatttgatcacattgaaaacacgaaacctgggaga
ggtggtgaaatccagcttacggatgcaatgaagtctcttttaaaagaagaaaaaattatt
ggtgtcgaagttgatttcaaaagatatgatatcggagacattaagggatggctagaagca
aacgttgaacttggaatagaaaacattgatgggtttaaggaatatattcgggaattgtgt
gataaataa

DBGET integrated database retrieval system