KEGG   Methanococcus maripaludis X1: GYY_06350Help
Entry
GYY_06350         CDS       T01584                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYY_06350
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GYY_06350
   00640 Propanoate metabolism
    GYY_06350
   00660 C5-Branched dibasic acid metabolism
    GYY_06350
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    GYY_06350
Enzymes [BR:mmd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GYY_06350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1185042..1186130
Genome map
AA seq 362 aa AA seqDB search
MKLHEYEAKEIFKENNIPIPKNKLVSGKVESIDYPVVIKAQVLVGGRGKAGGILFADNID
DANEKIESLIGNTVKGELVEKVLLEEQIKIAKEYYVGVVVNRNEKNNVVIFSTEGGVDIE
EVASKTPEKIIKLSLNPEKEFLPYLARGMLKKADIPSAEIPKVADVLCKVYKAFKNMDGI
LAEINPLIFTENGKIIAADAVLNVDDDAYFRHNYEKFEEFNKQEKSEFAYVELDGDIAVI
GNGAGLTLASMDIVKEFGGNPACFLDVGGGSNRETVKKALLKATSRRNVKGAFINILGGI
TRCDEVSMGIVDVLKENPNLKFAVRMMGTNEEEGRRILSENGISFESSMEGAAKALTELI
NS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaatatgaagcaaaggaaatttttaaagaaaataatatccctattcca
aaaaataaacttgtaagcggaaaggttgaaagtatcgattatcctgttgttataaaggcg
caagttttagttggtggaagaggtaaagctggcggaatcttatttgcagataatatcgat
gatgcaaacgaaaaaattgaatcattaattggaaacacggttaaaggcgaacttgttgaa
aaagtactcctcgaagagcagataaaaattgcaaaagaatattatgttggcgttgttgtt
aatagaaacgaaaaaaacaatgttgttatattttcaacagaaggtggagtagatatcgaa
gaagtagcttcgaaaactcctgaaaaaataataaaattatcattaaaccctgaaaaagaa
tttttaccataccttgcaagaggcatgcttaaaaaagcagatatcccaagtgcagaaatt
ccaaaagtagcagatgttttatgcaaagtttataaagcatttaaaaacatggatggaatt
ttagcggaaataaacccgctcatatttactgaaaatggaaaaatcattgctgctgatgca
gttttaaatgttgacgacgatgcatactttagacataactatgagaaatttgaagaattt
aataaacaggaaaaatccgaatttgcatatgttgaactggatggagacattgcagttatt
ggaaacggtgcaggactcacccttgcaagcatggacattgtaaaagaatttggcggaaat
cctgcatgtttcttagatgttggtggcggttcaaatagggaaaccgtaaaaaaagcactt
ttaaaagcaacctcccgaagaaacgttaaaggagcatttataaacattcttggcggaatt
acaaggtgtgatgaagtttcgatgggaattgtagatgttttaaaagaaaatccaaatctt
aagtttgctgtcaggatgatgggaacgaacgaagaagaaggaagaagaatattatctgaa
aatggaataagcttcgaaagctcgatggaaggggctgcaaaagcacttactgaattaata
aatagttaa

DBGET integrated database retrieval system