KEGG   Methanococcus maripaludis X1: GYY_06400Help
Entry
GYY_06400         CDS       T01584                                 

Definition
transketolase domain-containing protein
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYY_06400
   01230 Biosynthesis of amino acids
    GYY_06400
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GYY_06400
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    GYY_06400
Enzymes [BR:mmd01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     GYY_06400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1193566..1194393)
Genome map
AA seq 275 aa AA seqDB search
MKNTKNLNFEELAVKSKSLRYNIVKMIGLAESGHPGGSLSAIDIVSSLYYNIMNYDPKDP
KQDSRDRFILSKGHACPALYVTLADLGYFKEEELWSLRQLGALLQGHPTIEIPGIEVNTG
SLGQGFSSSVGVAIGCKLNKYENNVFVLLGDGECQEGQVWEAAMAAAHYKLDNLIGFVDR
NKLQIDGCTEDVMCLMDLKAKFSAFGFDVFEIDGHNFEEIVKTAELAKTMKNGKPKMIIA
NTTKGKGVSFMENNVGFHGKAPNKEELEKALAELQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacacaaaaaatttgaattttgaagaattagctgttaaatcaaaaagtttaaga
tataatattgtaaaaatgataggacttgcagaatctggacaccctggaggatctctttca
gcaattgacattgtatcatctctttactacaatattatgaactatgatccaaaagatcca
aaacaggattcaagagataggtttattttaagtaaaggtcacgcatgccctgcactttat
gtaacccttgcagatttaggctattttaaagaagaagaattatggagcttaagacagctt
ggagctcttttacaagggcacccaacaatcgagattcctggaattgaagtaaatactgga
tcattaggtcagggattttcatcctcagttggtgttgcaattggatgcaaattaaacaag
tacgaaaataatgtatttgtccttttaggagatggagaatgtcaggaaggacaggtttgg
gaagctgcgatggctgcggcacactacaaacttgataatttaattggttttgttgacaga
aacaaattacagattgacggatgtactgaagatgtaatgtgtttaatggacttgaaagct
aaattttctgcattcggttttgatgtatttgaaattgacggccacaacttcgaagaaatt
gttaaaaccgcagaacttgcaaaaacaatgaaaaacggaaagccaaaaatgattatcgca
aacacgacaaaaggaaaaggtgtttcattcatggaaaataacgttggcttccacggaaaa
gctccaaataaagaagagcttgaaaaagcactcgcggaacttcaataa

DBGET integrated database retrieval system