KEGG   Methanococcus maripaludis X1: GYY_06400Help
Entry
GYY_06400         CDS       T01584                                 

Definition
transketolase domain-containing protein
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:mmd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmd01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mmd00030]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of ansamycins
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1193566..1194393)
Genome map
AA seq 275 aa AA seqDB search
MKNTKNLNFEELAVKSKSLRYNIVKMIGLAESGHPGGSLSAIDIVSSLYYNIMNYDPKDP
KQDSRDRFILSKGHACPALYVTLADLGYFKEEELWSLRQLGALLQGHPTIEIPGIEVNTG
SLGQGFSSSVGVAIGCKLNKYENNVFVLLGDGECQEGQVWEAAMAAAHYKLDNLIGFVDR
NKLQIDGCTEDVMCLMDLKAKFSAFGFDVFEIDGHNFEEIVKTAELAKTMKNGKPKMIIA
NTTKGKGVSFMENNVGFHGKAPNKEELEKALAELQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacacaaaaaatttgaattttgaagaattagctgttaaatcaaaaagtttaaga
tataatattgtaaaaatgataggacttgcagaatctggacaccctggaggatctctttca
gcaattgacattgtatcatctctttactacaatattatgaactatgatccaaaagatcca
aaacaggattcaagagataggtttattttaagtaaaggtcacgcatgccctgcactttat
gtaacccttgcagatttaggctattttaaagaagaagaattatggagcttaagacagctt
ggagctcttttacaagggcacccaacaatcgagattcctggaattgaagtaaatactgga
tcattaggtcagggattttcatcctcagttggtgttgcaattggatgcaaattaaacaag
tacgaaaataatgtatttgtccttttaggagatggagaatgtcaggaaggacaggtttgg
gaagctgcgatggctgcggcacactacaaacttgataatttaattggttttgttgacaga
aacaaattacagattgacggatgtactgaagatgtaatgtgtttaatggacttgaaagct
aaattttctgcattcggttttgatgtatttgaaattgacggccacaacttcgaagaaatt
gttaaaaccgcagaacttgcaaaaacaatgaaaaacggaaagccaaaaatgattatcgca
aacacgacaaaaggaaaaggtgtttcattcatggaaaataacgttggcttccacggaaaa
gctccaaataaagaagagcttgaaaaagcactcgcggaacttcaataa

DBGET integrated database retrieval system