KEGG   Methanococcus maripaludis X1: GYY_06405Help
Entry
GYY_06405         CDS       T01584                                 

Definition
(GenBank) cellulase
Organism
mmd  Methanococcus maripaludis X1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1194732..1195784
Genome map
AA seq 350 aa AA seqDB search
MSTLDYLKILATEKGISGREDNIREYMKKELEKYCDSIETDKFGNLIAKKGSTGPKIMIA
SHMDEIGLMVKYIDDKGFLKFTKIGGINDQMLLNQKVIVHGNNGDIVGVLGSKPPHKMKE
SERNKLISAEHMFIDIGAKNREEAEKMGVEIGTAMSFKSEFDKLGGNVVSCKSFDNRAGC
AVVLKTMELLKDVDLKCQVYAVGTVQEEVGLKGAKTSAFGINPDVAFALDVTICGDHPGI
KLEDAPVELGKGPVATIVDASGRGIITHPTVLRMVRDVAKEDEIPVQYEVGEGGTTDATA
IHLTRDGIPTGVISVPSRYIHTPVEVIDTEDLEKTTELVVACIKKVHEYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtacactcgattatttaaagattctcgcaacagaaaaaggaatttctggtagagaa
gataatatacgagaatacatgaaaaaagaacttgaaaaatactgtgacagtattgaaaca
gataaatttggaaacttaattgcaaaaaaaggatctacaggtccaaaaatcatgattgca
tcacacatggatgaaatcgggctcatggttaaatatatagacgataaaggattcttaaaa
tttacaaaaattggcggaattaacgaccagatgctcttaaatcagaaagttatcgttcac
ggaaataacggcgatattgttggagttttaggatcaaaaccacctcacaaaatgaaagaa
agcgaaagaaacaaattaatttctgctgaacacatgtttatcgacatcggtgcaaaaaat
agggaagaagcagaaaaaatgggcgtagaaattggaactgcaatgtcattcaaatccgaa
tttgataaactcggtggaaatgtagtttcatgtaaatcattcgacaacagggcaggatgt
gcagttgttttaaaaaccatggaattactcaaagacgtggatttaaaatgccaggtttac
gctgtaggaacagttcaggaagaagttggattgaaaggtgcaaaaacatctgcatttgga
attaatcctgatgttgcattcgcacttgacgttacaatctgtggagaccacccaggaatt
aaattagaagatgcaccagttgaacttggaaaaggccctgttgcaacaattgttgatgca
tctggaaggggaattattacgcacccaacagttttaagaatggtaagagatgttgcaaaa
gaagatgagatacctgttcaatacgaagttggagagggcggaactactgacgcaaccgca
attcacttaacaagagatggaattccaacaggagttatatctgttccttcaagatacatc
cacaccccagttgaagttattgatacagaagatcttgaaaaaacaaccgaactcgttgtt
gcatgcattaaaaaagtacatgaatacttttaa

DBGET integrated database retrieval system