KEGG   Methanococcus maripaludis X1: GYY_06405Help
Entry
GYY_06405         CDS       T01584                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GYY_06405
Enzymes [BR:mmd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     GYY_06405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1194732..1195784
Genome map
AA seq 350 aa AA seqDB search
MSTLDYLKILATEKGISGREDNIREYMKKELEKYCDSIETDKFGNLIAKKGSTGPKIMIA
SHMDEIGLMVKYIDDKGFLKFTKIGGINDQMLLNQKVIVHGNNGDIVGVLGSKPPHKMKE
SERNKLISAEHMFIDIGAKNREEAEKMGVEIGTAMSFKSEFDKLGGNVVSCKSFDNRAGC
AVVLKTMELLKDVDLKCQVYAVGTVQEEVGLKGAKTSAFGINPDVAFALDVTICGDHPGI
KLEDAPVELGKGPVATIVDASGRGIITHPTVLRMVRDVAKEDEIPVQYEVGEGGTTDATA
IHLTRDGIPTGVISVPSRYIHTPVEVIDTEDLEKTTELVVACIKKVHEYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtacactcgattatttaaagattctcgcaacagaaaaaggaatttctggtagagaa
gataatatacgagaatacatgaaaaaagaacttgaaaaatactgtgacagtattgaaaca
gataaatttggaaacttaattgcaaaaaaaggatctacaggtccaaaaatcatgattgca
tcacacatggatgaaatcgggctcatggttaaatatatagacgataaaggattcttaaaa
tttacaaaaattggcggaattaacgaccagatgctcttaaatcagaaagttatcgttcac
ggaaataacggcgatattgttggagttttaggatcaaaaccacctcacaaaatgaaagaa
agcgaaagaaacaaattaatttctgctgaacacatgtttatcgacatcggtgcaaaaaat
agggaagaagcagaaaaaatgggcgtagaaattggaactgcaatgtcattcaaatccgaa
tttgataaactcggtggaaatgtagtttcatgtaaatcattcgacaacagggcaggatgt
gcagttgttttaaaaaccatggaattactcaaagacgtggatttaaaatgccaggtttac
gctgtaggaacagttcaggaagaagttggattgaaaggtgcaaaaacatctgcatttgga
attaatcctgatgttgcattcgcacttgacgttacaatctgtggagaccacccaggaatt
aaattagaagatgcaccagttgaacttggaaaaggccctgttgcaacaattgttgatgca
tctggaaggggaattattacgcacccaacagttttaagaatggtaagagatgttgcaaaa
gaagatgagatacctgttcaatacgaagttggagagggcggaactactgacgcaaccgca
attcacttaacaagagatggaattccaacaggagttatatctgttccttcaagatacatc
cacaccccagttgaagttattgatacagaagatcttgaaaaaacaaccgaactcgttgtt
gcatgcattaaaaaagtacatgaatacttttaa

DBGET integrated database retrieval system