KEGG   Methanococcus maripaludis X1: GYY_06760Help
Entry
GYY_06760         CDS       T01584                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GYY_06760
Enzymes [BR:mmd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     GYY_06760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258813..1259355
Genome map
AA seq 180 aa AA seqDB search
MDLTEFIKICRLLYDRKYVVGSGGNVSIRDGNLIYITPTGLSLGFLTKEDICIADLNGNI
IKGKPTSELNMHLKIYQNKNSVNAVVHTHSMYCTAFSALDKKLKLVTPEAEMVVKKIAYV
DYFPCGSLELAENVSKCLEDSIILKNHGIVTLGKDITEAYIKTEVLEEVAQLNYIMNNLK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggatttaactgaatttataaaaatatgccgtttattatacgatcgaaaatacgtcgtt
ggttctggaggaaatgtaagtattcgggatggaaatttaatatatattacgccaacgggt
ttaagtttaggatttttaacaaaagaagatatctgcattgctgatttaaatggaaacatc
ataaaaggaaaacctacttcagaattaaacatgcatttgaaaatataccaaaataaaaat
tcagtaaatgctgtagtccacacacactcaatgtactgcaccgcattttccgcacttgat
aaaaaactaaaattagtaacccctgaagctgaaatggttgttaaaaaaatagcatacgtt
gactatttcccatgcggaagtttagaacttgcagaaaatgtttcaaaatgccttgaagac
tcgattatcttaaaaaaccacggaattgttacattgggtaaagatataactgaagcatac
ataaaaaccgaagttttagaagaagttgcacagttaaattatattatgaacaatttaaaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system