KEGG   Methanococcus maripaludis X1: GYY_07125Help
Entry
GYY_07125         CDS       T01584                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mmd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1328301..1329269)
Genome map
AA seq 322 aa AA seqDB search
MLIRPRRLRKNQKIRDLVRETVLTKNDLIMPIFVDENLKNNEKTPITSMPGQFRYGVDSA
VKECVEISKLGVPGVILFGIPTEKDEFANSAVNENGGVQKVISKVKAELGDDLLVIADVC
MCEYTSHGHCGIIKGEEILNDETLEILGNIALSYAKAGVDIVAPSDMMDGRVLKIRNVLD
ENGFKNVSIMSYAAKYASAFYGPFRDAAESTPQFGDRKSYQMDMGNSREAIKEIELDIKE
GADLILVKPALPYLDIVKMAKEISNVPVGGYCVSGEYSMIEAAAEKGWLDREKVIYETLL
SIKRAGADFIITYWAKEAAKWL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttaataaggccaagaagacttagaaaaaaccagaaaatcagggatttggtaagggaa
accgttttaaccaaaaacgatttaataatgccaattttcgtagatgaaaacttaaaaaac
aatgaaaaaactccaattacctcaatgccagggcagtttcggtatggtgtagattccgca
gttaaagagtgcgtcgaaatttcaaaacttggggttcccggagtaattttgtttggaatt
ccaactgaaaaggacgaatttgcaaattctgcggtaaatgaaaacggtggagttcaaaag
gttatttcaaaagtaaaagccgaacttggagacgatcttttagtaattgcggatgtctgt
atgtgtgaatacacaagccacgggcactgcggtataattaaaggggaagaaattttaaac
gacgagacacttgaaatacttggaaatattgctctgtcatatgcaaaggcaggtgttgat
attgttgcaccatctgacatgatggatggaagggttttaaaaattagaaatgttttggat
gagaatggatttaaaaacgtttcaataatgagctatgctgcaaaatacgcatctgcattt
tacgggccatttagggatgctgcagagagcacaccgcaattcggggatagaaaatcatac
cagatggatatgggaaactcaagagaagccataaaagagatagaacttgatataaaagaa
ggtgctgacttaattttggtaaaaccagctcttccgtatcttgatattgtaaaaatggca
aaagaaatatctaatgttccagtcggaggatactgtgtaagtggggagtattcaatgatt
gaagcagcagcggaaaaaggatggcttgatagggaaaaagtaatatatgaaacgctttta
agcataaaacgggcaggtgctgactttataataacatactgggcaaaagaagctgctaag
tggctataa

DBGET integrated database retrieval system