KEGG   Methanococcus maripaludis X1: GYY_07125Help
Entry
GYY_07125         CDS       T01584                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GYY_07125
Enzymes [BR:mmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GYY_07125
Exosome [BR:mmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GYY_07125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1328301..1329269)
Genome map
AA seq 322 aa AA seqDB search
MLIRPRRLRKNQKIRDLVRETVLTKNDLIMPIFVDENLKNNEKTPITSMPGQFRYGVDSA
VKECVEISKLGVPGVILFGIPTEKDEFANSAVNENGGVQKVISKVKAELGDDLLVIADVC
MCEYTSHGHCGIIKGEEILNDETLEILGNIALSYAKAGVDIVAPSDMMDGRVLKIRNVLD
ENGFKNVSIMSYAAKYASAFYGPFRDAAESTPQFGDRKSYQMDMGNSREAIKEIELDIKE
GADLILVKPALPYLDIVKMAKEISNVPVGGYCVSGEYSMIEAAAEKGWLDREKVIYETLL
SIKRAGADFIITYWAKEAAKWL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttaataaggccaagaagacttagaaaaaaccagaaaatcagggatttggtaagggaa
accgttttaaccaaaaacgatttaataatgccaattttcgtagatgaaaacttaaaaaac
aatgaaaaaactccaattacctcaatgccagggcagtttcggtatggtgtagattccgca
gttaaagagtgcgtcgaaatttcaaaacttggggttcccggagtaattttgtttggaatt
ccaactgaaaaggacgaatttgcaaattctgcggtaaatgaaaacggtggagttcaaaag
gttatttcaaaagtaaaagccgaacttggagacgatcttttagtaattgcggatgtctgt
atgtgtgaatacacaagccacgggcactgcggtataattaaaggggaagaaattttaaac
gacgagacacttgaaatacttggaaatattgctctgtcatatgcaaaggcaggtgttgat
attgttgcaccatctgacatgatggatggaagggttttaaaaattagaaatgttttggat
gagaatggatttaaaaacgtttcaataatgagctatgctgcaaaatacgcatctgcattt
tacgggccatttagggatgctgcagagagcacaccgcaattcggggatagaaaatcatac
cagatggatatgggaaactcaagagaagccataaaagagatagaacttgatataaaagaa
ggtgctgacttaattttggtaaaaccagctcttccgtatcttgatattgtaaaaatggca
aaagaaatatctaatgttccagtcggaggatactgtgtaagtggggagtattcaatgatt
gaagcagcagcggaaaaaggatggcttgatagggaaaaagtaatatatgaaacgctttta
agcataaaacgggcaggtgctgactttataataacatactgggcaaaagaagctgctaag
tggctataa

DBGET integrated database retrieval system