KEGG   Methanococcus maripaludis X1: GYY_07205Help
Entry
GYY_07205         CDS       T01584                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYY_07205
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYY_07205
   00620 Pyruvate metabolism
    GYY_07205
   00640 Propanoate metabolism
    GYY_07205
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    GYY_07205
   00680 Methane metabolism
    GYY_07205
Enzymes [BR:mmd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GYY_07205
Lipid biosynthesis proteins [BR:mmd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GYY_07205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1345457..1347133)
Genome map
AA seq 558 aa AA seqDB search
MVSLLNKFVKKTEFESYEDFVENFKIDVPENFNFAYDIVDEYAKIAPEKIAIIWCDDNND
EKIFTFKDMKKYSDKAANFFLKHGIKKGDTVMLTLKSRYEFWFCMLGLHKIGAVAIPATH
MLTTKDIVYRIEKAGLKMIVCIGKNGVPDYVDEAVSEINSDVLKACVSNLNDNSWIDFSK
ELEESSEDFTRPVGEMDTKNDDVLVAYFSSGTTGYPKLIQHDHEYPLGHITTAKYWQNVE
DDGLHYTVADSGWAKCIWGKLYGQWIAGTAVFVYDYDRFDAGNMLEKIAKYKITTFCAPP
TIYRFMIKQDISKADFSSLHYAVTAGEPLNPEVYNKFLEFTGLRLMEGFGQTETVVSVAN
FTWMDPKPGSMGKPVPIFDLMIKGPDGKECDVGEEGELAFKTEDGKPLGLFSGYFKDPER
TKKAWYDGYYHTGDTAWKDEDGYLWFVGRNDDLIKSSGYRIGPFEVESALISHPAVLECA
ITGVPDPVRGQIVKATIVLTSEYQASEELKKELQDHVKHNTAPYKYPRAIEFVKELPKTI
SGKIRRVEIRETDEKSNN
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtatcattacttaataaatttgttaaaaagacggaatttgagtcatacgaagatttt
gtggaaaattttaagatagatgttccagaaaatttcaattttgcttacgatatcgttgac
gaatatgcaaaaattgcaccggaaaagattgcaatcatatggtgtgacgataacaacgac
gaaaaaatctttacattcaaagatatgaaaaaatacagtgataaagcagctaatttcttt
ttaaaacacggaattaaaaagggagacactgtaatgctcacattaaagagcaggtacgaa
ttctggttctgcatgcttggacttcataaaattggggctgtcgcaattcctgcaacacac
atgcttacaacaaaagacatcgtgtacaggattgaaaaagcaggcttaaaaatgatagtt
tgtatcggaaaaaacggagttcccgactacgttgatgaagcagtatctgaaattaattca
gatgttttaaaagcatgtgtttcaaatttaaacgataatagttggattgatttttcaaaa
gaattggaagaatcatcagaagactttacaaggcctgttggagaaatggatactaaaaat
gacgatgtattagttgcatatttttcatcaggaacaacaggatatccaaaattaattcag
cacgaccacgaatatcctttaggacatattacgactgcaaaatactggcaaaatgttgaa
gatgatggacttcactacactgttgcagacagtggatgggcaaagtgtatctggggaaaa
ctctacggacagtggattgcaggaactgcagtatttgtctacgactacgacagatttgat
gcaggaaatatgcttgaaaaaattgcaaaatacaaaattacaacgttctgcgcaccacct
acaatttaccggttcatgattaaacaggatatttcaaaagcagacttttcaagtttacac
tacgcagtaactgctggagaaccactaaaccctgaagtttacaacaaatttttggagttt
actgggcttaggctaatggaaggatttgggcagactgaaactgttgtatctgttgcaaac
tttacatggatggatccaaaaccaggatcaatgggaaaaccagtgccaatttttgatcta
atgataaaagggccagacggaaaagaatgcgatgtaggtgaagaaggagaacttgcattc
aaaacagaagatggaaaacctcttggtcttttctcaggatactttaaagaccctgaaaga
actaaaaaagcctggtacgatggatattaccatactggggacactgcatggaaagatgag
gatggatacctctggtttgttggaagaaacgacgatttaatcaaaagttccggttacaga
atcggtcctttcgaagtagaaagtgcacttatttcacaccctgcggtacttgaatgtgca
ataactggagtacctgacccagtacggggacagattgttaaagctacaattgttttaact
tctgaatatcaagcaagtgaagaactcaaaaaagaacttcaagaccacgttaaacacaac
actgctccatacaaataccctcgagctattgaatttgtaaaagaactcccaaaaacaatc
agcgggaaaatcaggcgtgtagaaatccgggaaactgatgaaaaaagtaataattaa

DBGET integrated database retrieval system