KEGG   Methanococcus maripaludis X1: GYY_07290Help
Entry
GYY_07290         CDS       T01584                                 

Definition
glycoside hydrolase family protein
Orthology
K07405  
alpha-amylase [EC:3.2.1.1]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GYY_07290
Enzymes [BR:mmd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GYY_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1361045..1362268)
Genome map
AA seq 407 aa AA seqDB search
MLLSLNFEVHQPNRLRKSVNLNSGDLWNRYVDVELNKEIFNKVADKCYIPSNMIMLELID
NYDIELSYSITGVFLEQALEFNEEVVELFKDLAKTGNVEFLGETYHHSLSSLFEDHEEFK
EDILDHKKLIKELFGYKTTTFRNTELIFNNKIAETIKEMGFRGIFTEGANRILDWRSPNY
VYSALSGLNVLFRNYNLSDDIGFRFSSRDWKEYPLMADKYASWLSNTPGDCINLYMDYET
FGEHQWADTGIFEFLRYLPKELENYNHIEYSTPSEILELCTPKDTVDVFEFSTLSWADSE
RDLSAWLGNRMQQLSFQRLKEIRKYLGNYLKRYDEKERKELIEYKIYKNMQTSDNFYYMC
TKGFNDMDVHSYFSHFSTPYDAYSAYLDAYYDFKNHLVLKLISTYFK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgttgctgtctcttaatttcgaggtccatcaaccaaacaggctcagaaaatctgtaaat
ttaaacagtggggatttatggaaccgctatgttgacgtagaattaaacaaagaaattttt
aacaaggtagccgataagtgctatatcccgtcaaatatgataatgctcgaattaattgat
aattatgatattgagctatcttacagtattacaggcgtttttttagaacaggctctcgaa
tttaatgaagaagtcgttgaattatttaaagatttagcaaaaactggaaatgtggaattt
ttaggtgagacttaccaccattcattatctagtctttttgaagatcacgaagagtttaag
gaagatattctcgatcataaaaaattaataaaagagcttttcgggtacaaaacaacgaca
tttagaaatacagaattgatttttaataataaaattgcagaaacaatcaaagaaatgggt
tttaggggaatatttaccgaaggggctaaccgtattttagattggaggtctccaaattac
gtttacagtgcattatctggattaaacgtactttttagaaattacaacttaagcgatgat
ataggatttagattttcttcaagggattggaaagaataccccttaatggctgacaaatat
gcaagctggctttcaaatactcccggggactgtataaatttatacatggactatgaaaca
tttggagaacaccagtgggcagataccggaatttttgaatttttaaggtatcttccaaaa
gagttggaaaattataaccatatcgaatattcaaccccttctgaaatacttgaattgtgt
actccaaaagataccgttgatgtttttgaattttcaactctttcgtgggccgattcagaa
agagatctgagtgcatggcttggaaaccggatgcagcagttatccttccaaagattaaaa
gaaataaggaaatacttaggtaattatttaaaacgatatgatgaaaaagagcgaaaagag
ttaatagaatataaaatctataagaatatgcagactagtgataatttttactacatgtgc
acgaaaggtttcaatgatatggatgttcattcctatttcagccatttttcaacgccttat
gacgcttattcggcgtatcttgatgcatattatgattttaagaatcatctagttttaaaa
ctaatttcaacatatttcaagtag

DBGET integrated database retrieval system