KEGG   Methanococcus maripaludis X1: GYY_07820Help
Entry
GYY_07820         CDS       T01584                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GYY_07820
  Amino acid metabolism
   00300 Lysine biosynthesis
    GYY_07820
Enzymes [BR:mmd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     GYY_07820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1465672..1466919
Genome map
AA seq 415 aa AA seqDB search
MKSILDETIELSSDLISINSVNPTFGGIGEKEKSIYIKNKLEEYNKNYSIKNCEINEYNT
VDSEGIERPNIVSKYDFGKNDTITIISHMDIVPEGDLGLWNSDPFKAEIKDGIIYGRGSE
DNHKGIVSSFLLLKMIFEEKIDPKYNLNLIFVADEEDGSKYGLSYLVNNFEDELFSSNDL
IIVPDFGMPEGEFIEIAEKNILWLKFKITGKQCHGSVPENGINADLIAFSFGKGLYDKLY
GKYNGINPIFNPPFSTFEPTILKNNIENINTIPGYVELNFDCRIIPKYDPKEVLSDIEKY
IEVFKNEIEKHILHFDISEKENISINYEILKLEKAEETKKDSEVVKKLGSAIKNVLNKEP
ILCGMGGGTVAAFLREKGYNTAVWGIGDETAHQPNEHIKIENLIKMAEVYLDILK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtattttggatgaaactattgaactttcttctgatctaatatccataaactca
gtaaatccaacttttggtggaattggggaaaaagaaaagtcaatttacataaaaaataag
ctagaagaatataataaaaattattcaataaaaaattgcgaaataaacgaatacaatacc
gttgattcagaaggaattgaaaggccaaatatcgtttcaaaatacgattttggaaaaaat
gataccattacaataatttcacacatggacatagttcctgaaggggaccttggcctctgg
aactccgacccatttaaagctgaaataaaagacgggataatttatggcaggggcagtgaa
gacaaccataaaggaatagtttcatcgtttttgcttttaaagatgatttttgaagaaaaa
atcgatccaaaatataatctaaatctaatttttgtagctgacgaagaagacggcagtaaa
tacggtctatcttaccttgtaaataattttgaagatgaactttttagctcaaacgatttg
ataattgttccggattttggaatgcccgaaggagaatttatagaaattgctgaaaaaaac
atactatggctaaaatttaaaattactggaaaacagtgccatggaagtgttcctgaaaat
ggaataaacgcagatttaatcgcattttcatttggaaaaggactttacgataaactctac
ggtaaatataacggcataaatccaatattcaaccctccattttcaacgtttgaacctaca
attttgaaaaataacattgaaaacataaatacaattccaggatacgttgaattaaatttt
gattgcagaattattccaaaatacgatccaaaagaagtactaagcgatattgaaaagtat
attgaagtttttaaaaatgaaattgaaaaacatattcttcattttgatatttctgaaaaa
gaaaatatttcgataaattacgagattttaaaacttgaaaaagcagaagaaacaaaaaaa
gattcagaagttgttaaaaaactgggttctgcaattaaaaacgtgttaaataaagaacca
attttatgcggaatgggtggtggaaccgttgccgcatttttaagagaaaaaggatacaac
actgcagtttggggaattggagacgaaactgcacaccagccaaatgaacatataaaaata
gaaaatttaataaaaatggcagaagtgtatcttgatatattaaaataa

DBGET integrated database retrieval system