KEGG   Methanococcus maripaludis X1: GYY_08470Help
Entry
GYY_08470         CDS       T01584                                 

Definition
ribonuclease III
Orthology
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
mmd  Methanococcus maripaludis X1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1569559..1570245
Genome map
AA seq 228 aa AA seqDB search
MKNFEKLLSKLDIRFNDLNIFKRAFMHSSYVNEQKNTNLEDNERLEYLGDAVLELIISEY
LFKKENLSEGEMSKLRAKYVCESALFTYAKKLKFNNYVLLGKGEINSKGYNKPAIVSDVF
EAFIAAIYLDQGLDSAKKFVYNHIIPIIEESSKELFIDYKTKLQEFPELINKSINYVNLE
ETGEAHDKKFVIAVKSGRKILGKGIGKSKKEAEMKAAKNALLKLEKKI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttgaaaagctgctttcgaaacttgatatacgatttaatgatttaaatata
tttaaacgagcatttatgcattcttcatacgtaaatgaacaaaaaaatactaatttagaa
gataatgaacgattggaatatttaggggatgctgttttagaattgataattagtgaatac
ttgtttaaaaaagaaaatttatctgaaggagaaatgtcaaaattgcgggcaaaatacgtc
tgtgaaagtgcactttttacttatgctaaaaaacttaaatttaacaattacgtgctttta
ggaaaaggagaaataaattctaaagggtacaataaacctgcaatagtttcagacgttttt
gaggcatttatcgccgcaatatatttagatcagggtttagattcagctaaaaagtttgta
tataatcacataatcccaattattgaagaaagttcaaaagaattgtttatcgattacaaa
actaaattgcaggaatttccagaattaatcaataaatcaataaattatgtaaatttagaa
gaaactggcgaagctcacgataaaaaatttgttattgccgtaaaatctgggcgaaaaata
cttggtaagggaattggaaaaagtaaaaaggaagctgaaatgaaagctgctaaaaatgca
cttttaaagcttgaaaaaaagatttag

DBGET integrated database retrieval system