KEGG   Methanococcus maripaludis X1: GYY_08470Help
Entry
GYY_08470         CDS       T01584                                 

Definition
(GenBank) ribonuclease III
  KO
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
mmd  Methanococcus maripaludis X1
Brite
Enzymes [BR:mmd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     GYY_08470
Messenger RNA biogenesis [BR:mmd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     GYY_08470
Ribosome biogenesis [BR:mmd03009]
 Eukaryotic Type
  90S particles
   RNase
    GYY_08470
 Prokaryotic Type
  rRNA processing factors
   GYY_08470
Chromosome [BR:mmd03036]
 Eukaryotic Type
  RNA silencing
   microRNA pathway
    Microprocessor complex
     GYY_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1569559..1570245
Genome map
AA seq 228 aa AA seqDB search
MKNFEKLLSKLDIRFNDLNIFKRAFMHSSYVNEQKNTNLEDNERLEYLGDAVLELIISEY
LFKKENLSEGEMSKLRAKYVCESALFTYAKKLKFNNYVLLGKGEINSKGYNKPAIVSDVF
EAFIAAIYLDQGLDSAKKFVYNHIIPIIEESSKELFIDYKTKLQEFPELINKSINYVNLE
ETGEAHDKKFVIAVKSGRKILGKGIGKSKKEAEMKAAKNALLKLEKKI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttgaaaagctgctttcgaaacttgatatacgatttaatgatttaaatata
tttaaacgagcatttatgcattcttcatacgtaaatgaacaaaaaaatactaatttagaa
gataatgaacgattggaatatttaggggatgctgttttagaattgataattagtgaatac
ttgtttaaaaaagaaaatttatctgaaggagaaatgtcaaaattgcgggcaaaatacgtc
tgtgaaagtgcactttttacttatgctaaaaaacttaaatttaacaattacgtgctttta
ggaaaaggagaaataaattctaaagggtacaataaacctgcaatagtttcagacgttttt
gaggcatttatcgccgcaatatatttagatcagggtttagattcagctaaaaagtttgta
tataatcacataatcccaattattgaagaaagttcaaaagaattgtttatcgattacaaa
actaaattgcaggaatttccagaattaatcaataaatcaataaattatgtaaatttagaa
gaaactggcgaagctcacgataaaaaatttgttattgccgtaaaatctgggcgaaaaata
cttggtaagggaattggaaaaagtaaaaaggaagctgaaatgaaagctgctaaaaatgca
cttttaaagcttgaaaaaaagatttag

DBGET integrated database retrieval system