KEGG   Methanococcus maripaludis X1: GYY_08685Help
Entry
GYY_08685         CDS       T01584                                 

Definition
tetrahydromethanopterin S-methyltransferase subunit G (EC:2.1.1.86)
Orthology
K00583  
tetrahydromethanopterin S-methyltransferase subunit G [EC:2.1.1.86]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GYY_08685
  Energy metabolism
   00680 Methane metabolism
    GYY_08685
Enzymes [BR:mmd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     GYY_08685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1605075..1605299
Genome map
AA seq 74 aa AA seqDB search
MSEIPTVVTPTKDYKRLQAKLDEIENTVENTNAEIIQRTGKKAGRDVGIAYGLAIGFIFV
YVLGTVLPLFDLIK
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaattccaacagtagtcacaccaacaaaagactacaaaagacttcaagcaaaa
ctcgatgaaatcgaaaacaccgttgaaaataccaacgctgaaataatccagagaaccggt
aaaaaggcaggaagagacgtaggtattgcctacggactcgcaataggatttatattcgta
tatgttctcggaaccgttttaccattatttgacttaataaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system