KEGG   Methanococcus maripaludis X1: GYY_08740Help
Entry
GYY_08740         CDS       T01584                                 

Definition
histone acetyltransferase, ELP3 family protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mmd  Methanococcus maripaludis X1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1612143..1613765)
Genome map
AA seq 540 aa AA seqDB search
MSDYSEFIRCIISNLLVEKEKIKDLDPKRKKQKVEDIKARCLRKFDLNVGFPPNSDIISQ
ASEEEKKELLPLLRKKPIRTLSGVAVVAVMTSPEPCPHGKCSFCPGGKESNFGDVPQSYT
GKEPATMRGVMYNFDPYVQTSERLSQLEKVGHPTDKVELIIMGGTFPARDIEYQENFIKR
CLDAMNGEVSETLEKAQEKNETAKHRCVALTLETRPDYCNEKEINEMLKLGTTRVELGIQ
STNDEVLEFVKRGHGTDASIKATQLLKDSGLKVSYHLIPGLPKTTPKMDKETIKTVFENP
NFKPDLIKFYPCLVIPGTEVYELWQSGEFNPMTDEQAVEVITYGKSIMPKWVRTSRIQRD
IPVTVIDAGVKKSNLGELVYNNLEEKGIKCKCIRCREVGHVTYKKGIKPDLESIKLCRED
YESSGGKEIFLSFEDTKNDLLIGYLRLRIPNNPFRKEITDKSALIRQVHVCGQQKELEGS
SKELSWQHKGYGRLLIDEAEKIAREFNKDQVLINSGIGVREYYKKLGYKRVGPYMGKILK
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgactattcagaatttatacgttgtatcatttctaatcttttagttgaaaaggaa
aaaataaaagatctggacccaaagaggaaaaaacaaaaagtagaggatatcaaggcgaga
tgtcttcgtaaatttgatttaaacgtaggatttcctccaaattcggatattatcagtcag
gcttcagaagaggaaaaaaaggaattattgccacttttaagaaaaaaaccaataagaaca
ctttcaggagttgctgttgttgcagtaatgacttctccagaaccatgccctcacggaaaa
tgttcgttctgccctggtggaaaagaaagtaattttggagatgttccgcaaagttatact
ggaaaagaacctgcaacaatgcgtggagtgatgtataactttgatccatacgtccaaaca
agtgaacggctttcgcagcttgaaaaagtgggtcacccaacagataaggtagaattgata
ataatgggcggaacttttccagcaagagacattgaatatcaggaaaacttcataaaaaga
tgccttgatgcgatgaatggtgaagtttcagaaacacttgaaaaagcacaggaaaaaaac
gaaactgcaaagcacaggtgtgtggccctcacccttgaaacaaggcccgattactgcaat
gaaaaagaaataaatgaaatgctaaaattgggaacaacaagagttgaacttggaattcaa
agcacaaacgatgaagttttagagtttgtaaaaagaggacacggaactgatgcgtcaatt
aaagcaacccagcttttaaaagatagtggactaaaggtttcataccacttaattcccgga
cttccaaagacaactccaaaaatggataaagaaacaattaaaacagtatttgaaaatcca
aacttcaaaccagatttaattaaattttacccgtgcctcgtaattcctggaacagaagta
tacgaattatggcagagtggggaatttaatccaatgactgatgaacaggcagtagaagtt
attacttacggaaaatcgataatgccaaaatgggtcaggacgtcaagaattcaaagagat
attcctgtaaccgtaattgatgcaggggttaagaaaagtaaccttggagaactcgtttac
aataatttggaagaaaaaggaataaaatgtaaatgtatacgatgcagggaagttggacac
gttacatacaaaaaaggaataaagccagatttagaaagtattaaattatgcagggaagat
tacgaatcaagtggcggaaaagagatattcttatcgtttgaagatactaaaaacgatctt
ttgataggttatttaagacttaggattccaaataatccatttagaaaagaaataactgat
aaatctgcacttataagacaggttcatgtttgcggacagcagaaagaacttgaaggtagc
tcaaaagaactttcgtggcagcacaaaggctacggcagacttttaattgacgaagctgag
aaaatcgcaagagagttcaataaagatcaagtattaatcaatagcgggataggtgttcga
gaatactataaaaaacttggatacaaaagagtcggtccgtatatgggtaaaattcttaaa
taa

DBGET integrated database retrieval system