KEGG   Methanococcus maripaludis X1: GYY_08780Help
Entry
GYY_08780         CDS       T01584                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mmd  Methanococcus maripaludis X1
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mmd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GYY_08780
Enzymes [BR:mmd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GYY_08780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1620710..1621558
Genome map
AA seq 282 aa AA seqDB search
MYFEDFSKFLTAYDTFNDADFVIFGIPFDATTSYKPGARFGPDEVRNASWGLETFSPILK
KDLIDVKICDKYNLLMEGNQSEIINRAYSASKDILEAKKIPVMIGGEHSVTYPVVKAVKS
VYDDFAVIHFDAHCDLREEYMGNEQSHASVIRRTYDLTKDIFQFGIRSGDQDEWEFGWEN
TNISMEMPTKDDIKKIKELEKPVYVTIDIDVLDPAFVPGTGTPEPCGFTPKELINSLYLL
EEIKEKIVGFDVVEVSPHYDIGKITSVTAAKIIRELILTISK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtattttgaagatttttccaagtttctcacagcttatgatacatttaacgatgctgat
tttgttatttttggaattccttttgatgctacaacttcatacaaacccggtgcaagattt
gggcctgatgaagttagaaacgcttcatggggacttgaaacatttagcccaattttaaaa
aaagatttaatcgatgtaaaaatttgcgacaaatacaatcttttaatggaaggaaatcag
tctgaaattataaatcgagcatatagtgcttcaaaagatattttagaagctaaaaaaata
cctgtaatgattggtggagaacactctgtaacataccctgttgtaaaagctgtaaaatcg
gtttatgatgactttgcagtaattcacttcgatgcacactgcgatttaagagaagaatat
atgggaaatgaacagtcccatgcaagtgtaattagaagaacttacgatttaacaaaagat
atcttccagtttggaattagaagtggcgaccaagatgaatgggaatttggatgggaaaac
accaatatttcaatggaaatgcccacaaaagatgatatcaaaaagatcaaagaacttgaa
aaaccagtttacgtaacaattgacatcgatgtacttgaccctgcatttgtacctggaact
ggaactccagaaccttgcggatttacaccaaaagagcttataaactcactttatcttttg
gaagaaattaaagaaaaaattgttggttttgacgtggttgaagtttcaccacattacgac
atcggcaagattacatctgttaccgcagcaaaaatcattcgtgaattgatacttaccata
agcaaataa

DBGET integrated database retrieval system