KEGG   Marinomonas mediterranea: Marme_0690Help
Entry
Marme_0690        CDS       T01449                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mme  Marinomonas mediterranea
Brite
Enzymes [BR:mme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Marme_0690
Secretion system [BR:mme02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Marme_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
720867..721574
Genome map
AA seq 235 aa AA seqDB search
MKIRYIFGLLTLSLTLLAQSAFAGQEEIEKALQKAIPGAKIGSISEHSSAGLYVVSIENG
PTLHVTKDGKYFVLGDLYRVEDSGLVNETENAKMAKVEAMPEDQMIVFKAKDEKAHITVF
TDVDCGYCRMLHREVDQLNDLGITVRYMAYPRAGIGSPAYNTMVSIWCSDNPKYWMTQAK
QGEEVPQNKCENPVADQFNLGNSVGVRGTPSIVLSNGKFMPGYIEANRLAAELGL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcgttacatatttggtctgctgacactctctctgacattattagctcaatct
gctttcgcaggtcaggaagagatagaaaaagcactacaaaaagccattccaggcgcgaaa
atcggctcaatctctgagcacagttcagctggattatatgtcgtttccatagagaacggc
ccaacattgcatgtgacgaaagacggtaagtactttgttttaggtgacttataccgagtg
gaagattctgggttggtaaatgaaacggaaaacgccaaaatggcgaaagttgaagcgatg
ccagaagatcaaatgatcgttttcaaagcgaaggatgaaaaggcacatatcaccgtcttt
acggatgttgattgtggctattgccgtatgcttcatagagaggtcgatcagctgaatgac
ttgggtattaccgtgcgttacatggcttaccctcgtgctggaataggttcgccagcttat
aacacaatggtgagtatatggtgttcagataatcctaaatattggatgacacaagcgaaa
caaggcgaggaagtgcctcaaaacaaatgtgaaaaccctgtcgcggatcagtttaattta
ggtaattcggttggcgttcgtggtacaccaagtattgttttgagtaatggtaaatttatg
ccaggctacatcgaagccaacagactggctgctgaactaggcctctaa

DBGET integrated database retrieval system