KEGG   Marinomonas mediterranea: Marme_0692Help
Entry
Marme_0692        CDS       T01449                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mme  Marinomonas mediterranea
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marme_0692
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marme_0692
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Marme_0692
Enzymes [BR:mme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Marme_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
723154..724539
Genome map
AA seq 461 aa AA seqDB search
MKYISTRGQAPALSFGDVLLAGLANDGGLYIPETLPSYTKEEIASWASLSYQELAFKIMW
PFVEGEIPADDFKRMIDEAYSSFNHTSIAPMVQTGNNEWVLELFRGPTLAFKDFALQLLG
RLMDFVLEKRGEKLVIMGATSGDTGSAAIEGCRHSEHLDIFILHPYQRVSEVQRRQMTTI
IDDNVFNIAVKGNFDDCQGMVKTSFADQSFLKGAKLGAVNSINWARIMAQIVYYFSSALS
VGAPHRKVSFSVPTGNFGDIFAGYLAKQMGLPIDQLVVATNQNDILHRTIAENDMSRQSL
NVTLSPSMDIMVSSNFERLLFDAHGRDGDKINDLMQRFNQGDVTLDDSAWQFVKDNFDSY
KVDDEGTCDVIANVFSETQYLLDPHTAIGLEAARKCWKDKSVPMITLATAHPVKFPEAVE
KAGCESPSLPEHMKDLFEREESYDVLDNSIADVQQFVADRI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatttctactcgcggacaagctcctgcactgagttttggagatgttctcctt
gctggacttgctaatgatggcggtctttacattccagaaacgcttcctagctatacaaaa
gaagaaattgcgtcttgggcgtctctaagttaccaagaattggcttttaaaatcatgtgg
ccttttgttgaaggtgaaataccagccgacgactttaagcgtatgattgacgaggcttat
tctagctttaaccacacttccatcgcaccaatggtgcaaacgggtaacaacgagtgggtg
ttagagttgttccgtggaccaacgcttgcctttaaagactttgcgcttcagttacttggt
cgattaatggactttgttttggaaaagcgtggcgaaaagctggtaattatgggcgcgacg
tctggtgatactgggtctgctgcgattgaagggtgccgtcactccgaacatttagatatt
ttcatattacacccgtatcagcgcgtatctgaagttcagcgtcgccaaatgacaaccatc
atcgacgataacgttttcaatattgctgtaaaaggtaactttgacgattgtcaggggatg
gttaaaacaagttttgcagatcagtcgtttcttaagggcgcgaaacttggcgcagtaaac
tcgatcaactgggcgcgtattatggctcaaatcgtttactacttctcttctgctttgtcg
gttggagcaccacatcgtaaagtgtcgttctctgtacccactggtaattttggcgatatc
tttgctggttacttagctaagcagatgggtttgccgattgatcagctggttgttgcaaca
aaccagaatgatattttgcatcgtacgattgctgaaaatgatatgagtcgtcagtcatta
aatgtcactttatcgccaagtatggacatcatggtatcgagtaacttcgagcgtttgttg
tttgatgcgcatggtcgtgatggcgataaaattaatgatttaatgcagcgctttaatcaa
ggtgatgtaacgctggatgattcagcgtggcagtttgtgaaagataactttgacagctat
aaagtcgatgatgaaggcacttgtgatgttattgcaaacgtcttctcagaaactcagtat
cttctagatcctcatactgcgatcggtcttgaagcggctcgtaaatgctggaaagacaaa
tctgtccctatgattacattggcaacggcgcatccggttaaatttccagaagcggtggaa
aaagcagggtgtgaatcgccaagtttacctgaacatatgaaagacttgtttgagcgagaa
gagtcttatgatgttttggataattccattgcagatgttcaacagtttgttgcagaccgc
atttaa

DBGET integrated database retrieval system