KEGG   Marinomonas mediterranea: Marme_0975Help
Entry
Marme_0975        CDS       T01449                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mme  Marinomonas mediterranea
Pathway
mme00010  Glycolysis / Gluconeogenesis
mme00051  Fructose and mannose metabolism
mme00562  Inositol phosphate metabolism
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01120  Microbial metabolism in diverse environments
mme01130  Biosynthesis of antibiotics
mme01200  Carbon metabolism
mme01230  Biosynthesis of amino acids
Module
mme_M00002  Glycolysis, core module involving three-carbon compounds
mme_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marme_0975
   00051 Fructose and mannose metabolism
    Marme_0975
   00562 Inositol phosphate metabolism
    Marme_0975
Enzymes [BR:mme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Marme_0975
Exosome [BR:mme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Marme_0975
  Exosomal proteins of bladder cancer cells
   Marme_0975
  Exosomal proteins of melanoma cells
   Marme_0975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: ADZ90250
JGI: Marme_0975
UniProt: F2K4F1
Position
1098712..1099461
Genome map
AA seq 249 aa AA seqDB search
MSRRKIVAGNWKLNGSKDFLQNIVETLVSVNDVDVVIAPPFPYLEKASALVADLNGLSVS
AQNVSSYSDGAFTGEVSVAMLKDIGADSVIVGHSERRELFGETDAIVAEKISQVLKFGLT
PILCVGETLEQREQGSTIEVCSTQIKSVLDVVGAENFDNVVIAYEPVWAIGTGKSASSAE
AQEVHASIRKLLSESLEGLGKKVSILYGGSVKAANAKELFEQEDIDGALVGGASLKVEEF
NEIIKAAGI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgacgtaagattgttgcaggaaactggaaactgaacggctctaaggatttttta
cagaatattgtagaaactcttgtgtcggttaatgatgttgatgtcgttatcgcgccccca
tttccctatttggaaaaagcatctgctttggtcgctgatctaaatggtttgagtgtttcc
gcacagaacgtatcctcgtatagcgatggtgcttttactggcgaagtttctgtagcgatg
ttgaaagatattggtgctgactcagtgattgtaggtcactctgaacgacgtgaattgttt
ggtgaaaccgatgctattgtcgctgagaaaatatctcaagtacttaagtttgggttgact
ccaattttatgtgtcggtgaaacgttagagcagcgagaacaaggttctacaattgaagta
tgttcgactcaaataaagagcgtgcttgatgttgttggtgcggaaaactttgataatgtt
gtaattgcctatgaacccgtttgggcgattggcacagggaagtcagcttcaagtgcagag
gctcaagaagttcatgcatcgattaggaagctactttctgaatctctcgaaggtttgggt
aaaaaagtcagtattctttacggcggaagtgtgaaagcagcgaatgctaaagagcttttt
gagcaggaagatattgatggagcgctggttggcggtgcttctttgaaagtagaagagttt
aacgagattattaaggcggctggaatttaa

DBGET integrated database retrieval system