KEGG   Marinomonas mediterranea: Marme_1029Help
Entry
Marme_1029        CDS       T01449                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mme  Marinomonas mediterranea
Pathway
mme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01130  Biosynthesis of antibiotics
mme01230  Biosynthesis of amino acids
Module
mme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Marme_1029
Enzymes [BR:mme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Marme_1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADZ90304
JGI: Marme_1029
UniProt: F2JT86
Position
1156596..1157408
Genome map
AA seq 270 aa AA seqDB search
MQVDTPTILRKIIARKYEEIEERQQRTPLSNLEIAVTAANAHNKPRGFAKAMRAKISQGK
AAVIAEVKKASPSKGILRDHFVPKEIAKSYEKGGAACLSVLTDKDFFQGHEDFLVEARAA
CDLPVIRKDFLVDEYQVMEARAIGADCILLIAACLSGEQLRKLDAMARDLGMDVLVEVHN
RAELDLALEYTDTELLGINNRDLHTFELSLQHTFELMGHVPKDRLIVTESGIHTRDDVAA
MRENDIHSFLVGEAFMKADNPGDKLAELFK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttgacacacctacaattttaagaaagattattgctcgcaagtacgaagaaatt
gaagagcgccaacagcgtactcctttgtctaatcttgaaatcgcggtcacagcggcaaat
gcccataataaacctcgtggatttgcgaaagccatgcgtgcgaaaatttcgcaaggtaaa
gcggctgttatagcggaagttaaaaaagcctctccaagtaaaggcattcttcgtgatcac
tttgtgccgaaggaaattgctaaatcttacgaaaaaggcggagcagcttgtttgtctgtt
ctcacggataaagatttttttcagggccatgaagattttcttgtagaggcacgtgccgcg
tgtgatttgcctgtgattcgaaaagattttctagttgatgaatatcaagtgatggaggca
agggcgatcggcgcagattgtattctattgatcgcagcgtgtttgtcaggtgagcaatta
cgaaaattggatgcgatggcacgcgaccttggtatggatgtgctggtggaagtgcataat
cgagctgagttagatctcgctctagaatatacagataccgagctgcttggtattaataac
cgcgaccttcacacgttcgagctcagcttacagcatacttttgaacttatggggcatgtc
cctaaagatagactgattgtaacggagagcggcattcacactcgcgatgatgtcgctgca
atgagagaaaatgatattcactccttcttagttggtgaggcctttatgaaggctgataac
cctggtgataaactggctgaattattcaaataa

DBGET integrated database retrieval system