KEGG   Marinomonas mediterranea: Marme_1040Help
Entry
Marme_1040        CDS       T01449                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mme  Marinomonas mediterranea
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marme_1040
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marme_1040
   00052 Galactose metabolism
    Marme_1040
   00500 Starch and sucrose metabolism
    Marme_1040
   00520 Amino sugar and nucleotide sugar metabolism
    Marme_1040
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Marme_1040
   00524 Butirosin and neomycin biosynthesis
    Marme_1040
Enzymes [BR:mme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Marme_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1165303..1166274
Genome map
AA seq 323 aa AA seqDB search
MSHALIADLGGTNARFAIVPINQYQPQEVHVFSCKNFDTFFDAANAYLGKCSVELEFIDA
VVLAIAGPVNREVIRFTNNSWAFTKEEIQAHFGADKAVALLNDYDALGHCLEILPKDDLV
TIGEQEAIDLSAPSWVLGPGTGLGVACVVPQDGVANLVLPGEGGHVDISTNSDQEDFILQ
FLRERHTRVSAERVLSGMGIENIYEALCAREKIGKRLTAPEIGEAFLSGSDPIAKETMSQ
FFTFLGRVVGNLVLAVESRGGVYITGGIIPRYLDAFKESGFRKAMQEKGRMTGYVSPIPT
FVVMSEYPGLMGCANYASYLVSE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatgcattgattgctgatctaggtgggactaatgcgcgttttgccattgttcct
atcaatcaatatcagcctcaagaagtgcacgtgttttcgtgtaaaaacttcgatacattt
ttcgatgctgcgaatgcctatctgggtaaatgcagcgttgaactagagtttattgatgcg
gttgttttagccatcgctggccccgttaatcgcgaggttattcgttttacgaataactct
tgggcgtttacaaaagaagaaattcaggcgcattttggagcagataaagccgtagcgtta
ttgaacgactatgatgctttgggccactgcttagaaattttgcctaaagacgacttggta
acaattggcgagcaagaggcgattgacctaagtgctccgtcatgggtcctaggtcctgga
actggtcttggggttgcgtgtgtcgttcctcaggacggtgtcgctaacctagtactacca
ggtgaaggcgggcatgtcgatataagtaccaatagcgatcaggaagactttatccttcag
tttttgcgagaacggcatacacgtgtttctgctgagcgtgtcttgtccggtatggggatt
gagaatatttacgaagccttgtgtgcccgagagaaaataggtaagcgtttaactgctcct
gaaattggtgaagcattcctatcaggatcagatcccattgccaaagagacgatgagccaa
ttttttaccttcttagggcgtgttgttggaaacttggtcttggccgttgagagtcgtggt
ggcgtgtatattacaggtggtatcataccgcgttatctggatgcgtttaaagaaagtgga
ttcagaaaagcgatgcaagaaaaaggtcggatgacaggttatgtttcaccgatcccaacg
ttcgttgtgatgtcagaataccccgggctgatgggatgtgctaactatgcatcttatctc
gtatcagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system