KEGG   Marinomonas mediterranea: Marme_1150Help
Entry
Marme_1150        CDS       T01449                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mme  Marinomonas mediterranea
Pathway
mme00900  Terpenoid backbone biosynthesis
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Marme_1150
Enzymes [BR:mme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Marme_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ADZ90425
JGI: Marme_1150
UniProt: F2JU04
Position
1284927..1286105
Genome map
AA seq 392 aa AA seqDB search
MKQKICLLGATGSIGKSTLDVIALNSAQFELESVAANQNVERMAEICKQFRPSRAVMGSI
EARDRLAELCPELSTSFEYGSDAMESIASDPNSHQVMAAIMGFAGLKPTLAAIRAGKRVL
LANKESLVTAGKLFMDEVKSNSVTLMPIDSEHNAIFQSLPHNSQYAHKSGVDRLMLTASG
GPFRTWSKQEMASVTPEQACKHPNWSMGRKISVDSASLMNKGLELIEACWLFDVTPDDID
VVVHPESVIHSLVSYIDGSVICQMGNPDMKIPVAYGMTWPNRAATGVKPLNLFEVSQLNF
EKPDLNRFPNLRLASEAWFSGGSAMATLNAANEVAVDAFLNNKIRFLQISELNQEVLERS
EVIAVNNLDVVFDADKKARAMANKIVGSWSMK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaaaaatttgtctacttggtgccacaggctctattggtaaaagtacgcttgac
gtaattgctctgaattctgcccaatttgagttagagagtgttgcagcaaatcaaaacgtt
gaaagaatggcggagatttgcaagcagtttcgtccatcaagagctgtgatggggtccatt
gaagcacgggatcgtcttgctgagctgtgtcctgagctttccacgtcttttgaatatgga
tcggatgcaatggaaagtattgcatccgatcctaatagccatcaagttatggctgccatc
atgggctttgctggattaaaacctacgcttgcggcaataagagcaggtaagcgggtttta
ttagcaaacaaggaatcactagtgactgccggtaagcttttcatggatgaggtgaaaagt
aactcggtgactcttatgcccattgatagtgagcacaatgctatttttcaaagtttgcct
cacaatagtcagtatgcacataaatcgggtgtcgaccgcttgatgttaactgcgtcaggt
gggccttttagaacttggtctaaacaagagatggcttcggtcacaccggaacaggcttgt
aagcacccaaattggtcaatggggcgaaaaatttctgttgattccgcgtcattgatgaat
aaagggttggagctaattgaagcgtgttggttgtttgacgttactccagatgatattgat
gttgttgttcaccctgaaagtgtcattcactctctcgtttcttacatagatggctcggtt
atttgccagatgggtaatcccgatatgaagattccggttgcctatggaatgacgtggcca
aatcgtgcggcaacaggggtaaaacctcttaatttatttgaagtgtctcaactgaacttt
gaaaagccggatcttaatcgttttcctaatcttaggctcgcttctgaagcatggttttca
ggaggaagtgcgatggcgacactaaatgcggccaatgaggttgcagttgatgctttctta
aacaataagattcgttttttgcaaatttcagaattaaatcaagaagtcttggaacgctcc
gaagtaatcgcggtcaataatttggatgttgtatttgatgctgacaaaaaagctcgggca
atggccaataagattgttggttcatggagtatgaaatga

DBGET integrated database retrieval system