KEGG   Marinomonas mediterranea: Marme_1181Help
Entry
Marme_1181        CDS       T01449                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mme  Marinomonas mediterranea
Brite
Enzymes [BR:mme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Marme_1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1322358..1323020
Genome map
AA seq 220 aa AA seqDB search
MTSVLNELVRKTEPRATSMLAYLQESGIHQPDILKLMASLPRHEFVEPAFSHLAYSPTPL
PIGKNQTISQPLTVARMSEWLLQYARRGRVLEIGTGSGYQTCILANLFNKVHTIERQKAL
LDLAMKRLANFGVSNVEFHHGDGHLGWPTNISMDAIIVTALASKVPHALTNSLKEGGILI
MPIEDETPSIGCWQKTGEKWRRLEFAPAQFVPMLEGKEDA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggtattgaatgagttagtgcgaaaaacagagcccagagccacgtctatgttg
gcgtacttacaagaatctggtattcatcaaccagatatattaaagcttatggcaagtttg
cctcgtcatgagtttgttgagcccgctttttctcacttagcttactctccgacaccgctc
ccaattggtaaaaatcaaacaatcagccagcctttgacggtcgcaaggatgtcggaatgg
ctgcttcaatatgcaagacgcggacgtgtcttggagatagggacaggttctggctatcag
acgtgcattttggcgaatttatttaataaagtgcacactatcgagcgtcaaaaggcgcta
ttagatctggcgatgaaacgtctcgcaaattttggggtctcaaatgtagagtttcatcat
ggtgatgggcatttggggtggccaaccaatatttctatggacgccatcattgtcacagct
ttggcctctaaggtgcctcacgccttaacaaattcactaaaagaaggcggtattcttatc
atgccgattgaagatgaaaccccctctattggctgctggcaaaagacgggagaaaaatgg
cgtcgtttggagtttgctccagcgcagtttgtacctatgttagaaggaaaagaagatgcc
taa

DBGET integrated database retrieval system