KEGG   Marinomonas mediterranea: Marme_1268Help
Entry
Marme_1268        CDS       T01449                                 

Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mme  Marinomonas mediterranea
Pathway
mme00630  Glyoxylate and dicarboxylate metabolism
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01120  Microbial metabolism in diverse environments
mme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Marme_1268
Enzymes [BR:mme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Marme_1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADZ90541
JGI: Marme_1268
UniProt: F2JVJ7
Position
complement(1408535..1410127)
Genome map
AA seq 530 aa AA seqDB search
MSNYNKDIDDTATLIASQGDTWKAINPEFAARMKAQNRFRTGLDIARYTAKIMRADMERY
DSDPSQYTQSLGCWHGFIGQQKMISIKKHFNSTDRRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSSLIGELYTFLRQADARELGELFRSLDAARDAGDKATEEKVQAEVDNYQTHIVP
IIADIDAGFGNEEATYLLAKQMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKI
RAVRYAFLELGVEDGVIVARTDSLGAGLTKQIAVTAKEGDLGDQYNSFLDVEEVDASNMK
NGDVLLNQKGKLVRPKRLPSNLFQFKKGSGEDRVVLDCITSLQNGADLLWIETEKPHVQQ
IAGMVNRIREVVPNAKLVYNNSPSFNWTLNFRQQTFDAWSEAGKDLSAYDRANLMSVEYD
SSDLAAEADERIRTFQADAAKEAGIFHHLITLPTYHTAALSTDNLAKEYFGEQGMLGYVK
GVQRQEIRQGIACVKHQAMAGSNMGDDHKEYFSGDAALKASGKDNTMNQF
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctaattacaataaagatatcgacgacacagcaactttgatcgcaagccaaggtgat
acatggaaagcaatcaacccagaatttgcagcaagaatgaaagcgcaaaatcgctttcga
acaggcttggatattgctcgttatacggcgaagataatgcgagcagacatggaacgctat
gacagtgaccctagccaatacactcaatctctaggttgctggcatggctttatcggccaa
caaaaaatgatttcaatcaagaaacattttaactctaccgatcgacgttatttgtacctt
tcaggatggatggtcgcagcgcttcgctcagaatttggccctcttccagaccaatctatg
catgagaaaacctcagtatcaagtttgatcggagaactatacaccttcctacgtcaagca
gatgctagggaattaggcgaattattccgcagcttagatgcagctcgtgatgctggcgac
aaagctacagaagaaaaagtacaagctgaagtcgacaactaccaaactcacatcgtacct
atcattgctgatatcgatgcaggttttggtaacgaagaagccacttaccttcttgcgaaa
caaatgatcgaagcgggtgcttgctgtatccagatcgagaaccaagtatctgacgaaaaa
caatgtggccaccaagacggtaaagtaacggtaccgcacgaagatttcttagcgaaaatc
cgcgcggttcgttacgctttcctagaattgggtgttgaagacggcgttatcgttgcacgt
actgactcattgggtgctggcctaactaagcagatcgcagtaacagccaaagaaggcgac
ctaggcgaccaatacaacagcttcctagatgtggaagaagttgatgcaagcaacatgaaa
aatggcgatgtactccttaatcaaaaaggcaaactggttcgacctaagcgcttgccaagt
aacttattccaattcaaaaaaggttctggcgaagatcgcgtagtacttgattgcatcaca
tctctacaaaatggtgctgacctactttggatcgaaacagaaaaaccacatgtacagcag
attgcaggcatggttaaccgtattcgtgaagttgtgccaaatgcgaagcttgtttacaac
aactctccatctttcaactggacactaaacttccgtcagcaaacatttgatgcttggtcc
gaagcaggtaaagacctatccgcttatgatcgtgctaacctaatgtctgttgaatacgat
tcaagtgatctagcagcagaagcagatgagcgcatccgtactttccaagctgatgcagca
aaagaagcgggtatcttccaccacctaatcacattgccaacgtaccacacagccgcattg
tctacggacaatcttgcaaaagaatacttcggagagcaaggcatgctaggttatgtgaaa
ggagtacagcgtcaagaaatccgccaaggtattgcttgtgtaaaacaccaagcaatggct
ggatcaaacatgggcgacgaccacaaagagtacttctctggcgacgcagcactgaaggct
tcaggtaaagataacacaatgaaccaattctaa

DBGET integrated database retrieval system