KEGG   Marinomonas mediterranea: Marme_1269Help
Entry
Marme_1269        CDS       T01449                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mme  Marinomonas mediterranea
Pathway
mme00620  Pyruvate metabolism
mme00630  Glyoxylate and dicarboxylate metabolism
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01120  Microbial metabolism in diverse environments
mme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Marme_1269
   00630 Glyoxylate and dicarboxylate metabolism
    Marme_1269
Enzymes [BR:mme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Marme_1269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADZ90542
JGI: Marme_1269
UniProt: F2JVJ8
Position
1410420..1412585
Genome map
AA seq 721 aa AA seqDB search
MNRIHRNGLTIAKPLYDLVNNEILPETGVMPDVFWDGFEYAIETLAPINRALLEKREAMQ
KQLDEYNVSRNGDADSFGDYEGFLKQIGYIVPDGPAFQISTQNVDEEIATQAAPQLVVPV
KNARFALNAVNARWGSLYDALYGTDAIPEDGGAETTSEYNPIRGQKVVEFGRELLDQAAP
LLIGSHADVVQYAMVDGELVATLKNGDAVQLMDPKQCIGYRGKVASPETVLLVNNALHIE
IQIDRDGVIGRMDLAGVQDIVLEAAVTTIMDCEDSVAAVDAEDKVEVYQNWLGLMKGTLS
DRFEKGGRTVTRSMNPDRDYLDKLGNKYSLPGRSLMFIRNVGHLMTTPAILDKGGNEVPE
GIMDAFITSLAAIHDLKGNTSRKNSRAGSINIVKPKMHGPEEVAFTVTLFETVENVLGLA
PNTLKVGIMDEERRTTVNLKECIRAAKERVVFINTGFLDRTGDEIHSSMHAGAFVPKTEM
KKQAWIQAYEDWNVDIGLECGLPGKAQIGKGMWAMPDEMAAMLEQKGSHPLAGANTAWVP
SPNGATLHATHYHNINVAERQRELRSRNRASLNDILTLPLLPKERVLSDEEVQAELDNNT
QGILGYVVRWIDQGIGCSKVPDIHNIGLMEDRATLRISSQHIANWLLHGICSEEQVMDSL
KRTAKIVDQQNQSDASYSDIAPSYDGIAFKAASDLIFKGVAQPSGYTEPLLHAYRLEKKA
C
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaatccaccgtaatggcttaacaatagcgaaacctctctacgatttggtgaac
aatgagatacttcctgaaacaggagtcatgcctgatgttttttgggatgggtttgagtac
gcaatagagacattagcacccataaaccgagcgttattagaaaaacgtgaagccatgcaa
aaacagctagatgaatataatgtatctaggaatggggatgccgattcttttggtgactat
gagggctttctaaaacaaattgggtatattgtccctgatgggcctgcgtttcaaatttct
actcaaaatgtggatgaagagatagccactcaagcggcacctcaacttgtggtgcccgta
aaaaatgctcgattcgctttaaatgcggtaaacgcgcgatggggaagtttatacgatgcc
ctgtacggaacagatgcgattccagaagatggcggcgcagagactacgtctgaatataac
cctattcgagggcagaaagtggttgagtttggccgagagttactagaccaagccgcgcct
cttttaattggaagtcatgctgatgttgttcagtatgccatggttgatggtgagttggtt
gcgacacttaagaatggtgatgcggttcagttaatggatccgaagcagtgtattgggtat
agggggaaagtcgccagccctgagactgttttattggttaacaatgccctgcatatcgaa
attcaaattgatcgagacggagtgattggtcgaatggatttagcaggtgttcaagatatt
gttcttgaggctgccgttacgaccattatggattgtgaagactcggtagctgcggttgac
gcagaagataaagtggaagtgtatcaaaattggttggggttaatgaaaggcaccttatct
gatcgctttgaaaaaggtggtaggactgtcactcgtagtatgaatccagatcgggattat
ttggataaattgggtaataagtatagccttcccggtcgaagccttatgtttattcgaaat
gtcggtcacttgatgaccactccggctattttagataagggcggaaatgaggtaccagaa
ggtataatggatgcctttattacatcgttagctgctattcatgatttaaaaggcaatact
tctagaaagaacagtcgagcaggcagtattaatattgtgaagcctaaaatgcacggccct
gaagaagtggcctttacggttacactttttgaaaccgttgagaacgtgttaggtctggct
ccaaataccctaaaagtcggtatcatggatgaagagcgtagaacaacggtaaatctaaaa
gaatgtattcgcgctgcgaaagagcgcgtcgtctttattaatacggggttcttagatcgg
acgggggatgaaattcattcctcaatgcatgctggagcgtttgttcctaaaacggaaatg
aaaaaacaagcgtggatacaagcgtatgaagactggaatgtcgacattgggcttgaatgt
ggtcttccagggaaggcgcaaataggaaagggcatgtgggcaatgccagatgaaatggca
gcgatgcttgaacagaaaggctcacatcctttagctggggcgaataccgcttgggtgcca
tcaccaaatggtgcaacgcttcacgctactcattaccacaacattaatgtggcagagcgt
caacgcgagctacgcagtcgcaaccgagcgagtttaaacgatattctcactttgccgttg
cttcctaaagagcgtgtgttaagtgacgaagaggtccaagcggaattagataacaatacg
caagggattttggggtacgtagtgcgctggattgatcaaggtatcggatgctctaaagtg
ccagatatccataatatcggattaatggaagatagggcgacgctgaggatatcgtcacag
catatcgcgaactggttgttgcatggcatatgcagtgaggagcaggtaatggactcgttg
aaacgaacggcaaaaattgttgatcaacaaaatcagagtgatgccagctattctgacatt
gcgccgagttatgacggtattgctttcaaggctgctagcgatcttatttttaaaggcgtt
gctcagccttctggatacactgagcccttgcttcacgcttaccgtttagagaaaaaagca
tgctga

DBGET integrated database retrieval system