KEGG   Marinomonas mediterranea: Marme_1269Help
Entry
Marme_1269        CDS       T01449                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mme  Marinomonas mediterranea
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marme_1269
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Marme_1269
   00630 Glyoxylate and dicarboxylate metabolism
    Marme_1269
Enzymes [BR:mme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Marme_1269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1410420..1412585
Genome map
AA seq 721 aa AA seqDB search
MNRIHRNGLTIAKPLYDLVNNEILPETGVMPDVFWDGFEYAIETLAPINRALLEKREAMQ
KQLDEYNVSRNGDADSFGDYEGFLKQIGYIVPDGPAFQISTQNVDEEIATQAAPQLVVPV
KNARFALNAVNARWGSLYDALYGTDAIPEDGGAETTSEYNPIRGQKVVEFGRELLDQAAP
LLIGSHADVVQYAMVDGELVATLKNGDAVQLMDPKQCIGYRGKVASPETVLLVNNALHIE
IQIDRDGVIGRMDLAGVQDIVLEAAVTTIMDCEDSVAAVDAEDKVEVYQNWLGLMKGTLS
DRFEKGGRTVTRSMNPDRDYLDKLGNKYSLPGRSLMFIRNVGHLMTTPAILDKGGNEVPE
GIMDAFITSLAAIHDLKGNTSRKNSRAGSINIVKPKMHGPEEVAFTVTLFETVENVLGLA
PNTLKVGIMDEERRTTVNLKECIRAAKERVVFINTGFLDRTGDEIHSSMHAGAFVPKTEM
KKQAWIQAYEDWNVDIGLECGLPGKAQIGKGMWAMPDEMAAMLEQKGSHPLAGANTAWVP
SPNGATLHATHYHNINVAERQRELRSRNRASLNDILTLPLLPKERVLSDEEVQAELDNNT
QGILGYVVRWIDQGIGCSKVPDIHNIGLMEDRATLRISSQHIANWLLHGICSEEQVMDSL
KRTAKIVDQQNQSDASYSDIAPSYDGIAFKAASDLIFKGVAQPSGYTEPLLHAYRLEKKA
C
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaatccaccgtaatggcttaacaatagcgaaacctctctacgatttggtgaac
aatgagatacttcctgaaacaggagtcatgcctgatgttttttgggatgggtttgagtac
gcaatagagacattagcacccataaaccgagcgttattagaaaaacgtgaagccatgcaa
aaacagctagatgaatataatgtatctaggaatggggatgccgattcttttggtgactat
gagggctttctaaaacaaattgggtatattgtccctgatgggcctgcgtttcaaatttct
actcaaaatgtggatgaagagatagccactcaagcggcacctcaacttgtggtgcccgta
aaaaatgctcgattcgctttaaatgcggtaaacgcgcgatggggaagtttatacgatgcc
ctgtacggaacagatgcgattccagaagatggcggcgcagagactacgtctgaatataac
cctattcgagggcagaaagtggttgagtttggccgagagttactagaccaagccgcgcct
cttttaattggaagtcatgctgatgttgttcagtatgccatggttgatggtgagttggtt
gcgacacttaagaatggtgatgcggttcagttaatggatccgaagcagtgtattgggtat
agggggaaagtcgccagccctgagactgttttattggttaacaatgccctgcatatcgaa
attcaaattgatcgagacggagtgattggtcgaatggatttagcaggtgttcaagatatt
gttcttgaggctgccgttacgaccattatggattgtgaagactcggtagctgcggttgac
gcagaagataaagtggaagtgtatcaaaattggttggggttaatgaaaggcaccttatct
gatcgctttgaaaaaggtggtaggactgtcactcgtagtatgaatccagatcgggattat
ttggataaattgggtaataagtatagccttcccggtcgaagccttatgtttattcgaaat
gtcggtcacttgatgaccactccggctattttagataagggcggaaatgaggtaccagaa
ggtataatggatgcctttattacatcgttagctgctattcatgatttaaaaggcaatact
tctagaaagaacagtcgagcaggcagtattaatattgtgaagcctaaaatgcacggccct
gaagaagtggcctttacggttacactttttgaaaccgttgagaacgtgttaggtctggct
ccaaataccctaaaagtcggtatcatggatgaagagcgtagaacaacggtaaatctaaaa
gaatgtattcgcgctgcgaaagagcgcgtcgtctttattaatacggggttcttagatcgg
acgggggatgaaattcattcctcaatgcatgctggagcgtttgttcctaaaacggaaatg
aaaaaacaagcgtggatacaagcgtatgaagactggaatgtcgacattgggcttgaatgt
ggtcttccagggaaggcgcaaataggaaagggcatgtgggcaatgccagatgaaatggca
gcgatgcttgaacagaaaggctcacatcctttagctggggcgaataccgcttgggtgcca
tcaccaaatggtgcaacgcttcacgctactcattaccacaacattaatgtggcagagcgt
caacgcgagctacgcagtcgcaaccgagcgagtttaaacgatattctcactttgccgttg
cttcctaaagagcgtgtgttaagtgacgaagaggtccaagcggaattagataacaatacg
caagggattttggggtacgtagtgcgctggattgatcaaggtatcggatgctctaaagtg
ccagatatccataatatcggattaatggaagatagggcgacgctgaggatatcgtcacag
catatcgcgaactggttgttgcatggcatatgcagtgaggagcaggtaatggactcgttg
aaacgaacggcaaaaattgttgatcaacaaaatcagagtgatgccagctattctgacatt
gcgccgagttatgacggtattgctttcaaggctgctagcgatcttatttttaaaggcgtt
gctcagccttctggatacactgagcccttgcttcacgcttaccgtttagagaaaaaagca
tgctga

DBGET integrated database retrieval system