KEGG   Marinomonas mediterranea: Marme_1309Help
Entry
Marme_1309        CDS       T01449                                 

Definition
(GenBank) Phospholipase A(1)
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
mme  Marinomonas mediterranea
Pathway
mme00564  Glycerophospholipid metabolism
mme00565  Ether lipid metabolism
mme00592  alpha-Linolenic acid metabolism
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Marme_1309
   00565 Ether lipid metabolism
    Marme_1309
   00590 Arachidonic acid metabolism
    Marme_1309
   00591 Linoleic acid metabolism
    Marme_1309
   00592 alpha-Linolenic acid metabolism
    Marme_1309
Enzymes [BR:mme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Marme_1309
    3.1.1.32  phospholipase A1
     Marme_1309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ADZ90582
JGI: Marme_1309
UniProt: F2JVN8
Position
1465476..1466492
Genome map
AA seq 338 aa AA seqDB search
MVALRQVVAETTKNIIRVIVLLAVIGSCVVNVAFATSQQLDGSEALKTEDETSLGIPLPK
EPEVPESIQQRVQQDGLIRQRTLREQSSLSNPFVLTPHRPNYFLPVTYTDDPNGREFVVN
DSSDGVLDNVEFKFQLSVKFPVAYDIVGRGSTLWFAYTQQAFWQAYNSKISAPFRDTSHE
PEAFIVDKLDGQFLGVTPSYIAYGINHQSNGQSGARSRSWNRLFVDVVFEYEHLAVSIKP
WYRIHENREDDDNPNIERYLGYGEVAAVLIDEDYSYDVMIRNNLRSSNKGAIQLGVNFPL
WGKTRGYVQYFEGYGQSLLDYNNHVRSLGFGIMLTNWL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggtggctctgcgccaagttgtggctgagacaacaaagaatattattcgagtcattgtt
ttgttggctgtgataggtagttgtgtcgtgaatgtcgcttttgccacctctcaacagctc
gatggtagtgaggcattaaagacagaggacgaaacttcgctggggattcctttgccaaaa
gagccagaggtccctgagagcatacaacagcgggttcagcaagatggtttgattcgccag
cgaactttaagggagcagagctcgttgtcaaacccatttgttttgacgccacaccgcccc
aattattttttacccgttacctacacagacgatcctaacggtagagagtttgttgtaaac
gacagtagcgacggggttcttgacaatgttgagtttaaatttcaactaagtgtgaaattt
cccgtggcgtatgacattgttgggcgtggctctactctgtggttcgcttatacgcagcaa
gctttctggcaagcgtataatagtaaaatatcagcaccctttagagacacctctcatgag
ccagaggcgtttatcgtggataagctcgatggccagtttttgggcgtcacaccttcgtac
atagcttacggaatcaaccatcaatctaatggtcaaagtggtgcgaggtctcgttcttgg
aatcgtctgtttgttgatgttgtttttgaatatgaacatcttgccgtgtcgattaagcct
tggtaccgcatacatgaaaaccgtgaggacgatgacaaccctaatattgagcggtatctc
ggttacggtgaagtggcggcagtcttaattgatgaggattacagctatgacgtaatgatc
agaaataatcttcgttcaagtaataaaggcgcgatacagcttggcgttaatttccctctt
tgggggaaaacacgagggtatgtgcaatactttgaaggttatggtcaatctctcttggat
tataataatcatgtgcgaagtttaggttttggaattatgcttaccaattggctttag

DBGET integrated database retrieval system