KEGG   Marinomonas mediterranea: Marme_1315Help
Entry
Marme_1315        CDS       T01449                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mme  Marinomonas mediterranea
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mme00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1471320..1472006
Genome map
AA seq 228 aa AA seqDB search
MSTAIAEEKSSLELIGLSEEAVKVRDALVKHGLETPMIENGLSTEEKYQRIKSAFEDVVY
TLGLDMNDDSLAETPHRIAKMYVREIFSGLDYAKFPKITVIDNKMNVDEMVKVNNISFTS
TCEHHFVTIDGFAKVAYLPKKKIIGLSKINRIVRFFGQRPQVQERLTQQILVTLQTLLET
DNVAVSIEATHYCVKARGVMDASSSTQTTALGGLFKRSDKTRGEFLSN
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgcaattgcagaagagaagtcttctttagagttgatcggattgtccgaagaa
gcagtaaaagtgcgagatgcgctcgttaagcacggtttagagacaccgatgattgaaaac
ggattgtcgactgaggagaagtatcagcgaatcaaatccgcctttgaagacgttgtgtac
acactcggtcttgatatgaacgacgatagtttggcagaaacgcctcaccgaatcgcaaaa
atgtatgtccgagaaatattctcggggctagattacgctaaattcccgaaaatcacggtc
attgacaacaaaatgaatgttgatgaaatggtgaaggtgaacaatattagttttacaagt
acctgcgagcatcactttgtcactattgacgggtttgcgaaggtggcgtatctacctaag
aaaaaaattatagggttatcaaagatcaaccgtattgttagattctttggccaacggcct
caggtgcaagaacgtttaacgcagcaaatcttagtgacactgcagacacttcttgaaacc
gataacgtcgcggtaagtatagaagccacgcattactgtgttaaagctcgaggtgttatg
gacgctagttcatcgacgcagacgacggcactaggtgggttatttaagcgcagcgataaa
actcgaggtgagtttttatctaactag

DBGET integrated database retrieval system