KEGG   Marinomonas mediterranea: Marme_1315Help
Entry
Marme_1315        CDS       T01449                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
mme  Marinomonas mediterranea
Pathway
mme00790  Folate biosynthesis
mme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Marme_1315
Enzymes [BR:mme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Marme_1315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADZ90588
JGI: Marme_1315
UniProt: F2JVP4
Position
1471320..1472006
Genome map
AA seq 228 aa AA seqDB search
MSTAIAEEKSSLELIGLSEEAVKVRDALVKHGLETPMIENGLSTEEKYQRIKSAFEDVVY
TLGLDMNDDSLAETPHRIAKMYVREIFSGLDYAKFPKITVIDNKMNVDEMVKVNNISFTS
TCEHHFVTIDGFAKVAYLPKKKIIGLSKINRIVRFFGQRPQVQERLTQQILVTLQTLLET
DNVAVSIEATHYCVKARGVMDASSSTQTTALGGLFKRSDKTRGEFLSN
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgcaattgcagaagagaagtcttctttagagttgatcggattgtccgaagaa
gcagtaaaagtgcgagatgcgctcgttaagcacggtttagagacaccgatgattgaaaac
ggattgtcgactgaggagaagtatcagcgaatcaaatccgcctttgaagacgttgtgtac
acactcggtcttgatatgaacgacgatagtttggcagaaacgcctcaccgaatcgcaaaa
atgtatgtccgagaaatattctcggggctagattacgctaaattcccgaaaatcacggtc
attgacaacaaaatgaatgttgatgaaatggtgaaggtgaacaatattagttttacaagt
acctgcgagcatcactttgtcactattgacgggtttgcgaaggtggcgtatctacctaag
aaaaaaattatagggttatcaaagatcaaccgtattgttagattctttggccaacggcct
caggtgcaagaacgtttaacgcagcaaatcttagtgacactgcagacacttcttgaaacc
gataacgtcgcggtaagtatagaagccacgcattactgtgttaaagctcgaggtgttatg
gacgctagttcatcgacgcagacgacggcactaggtgggttatttaagcgcagcgataaa
actcgaggtgagtttttatctaactag

DBGET integrated database retrieval system