KEGG   Marinomonas mediterranea: Marme_1510Help
Entry
Marme_1510        CDS       T01449                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mme  Marinomonas mediterranea
Pathway
mme00020  Citrate cycle (TCA cycle)
mme00190  Oxidative phosphorylation
mme00650  Butanoate metabolism
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01120  Microbial metabolism in diverse environments
mme01130  Biosynthesis of antibiotics
mme01200  Carbon metabolism
Module
mme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mme_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Marme_1510
   00650 Butanoate metabolism
    Marme_1510
  Energy metabolism
   00190 Oxidative phosphorylation
    Marme_1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADZ90776
JGI: Marme_1510
UniProt: F2JY40
Position
1684390..1684737
Genome map
AA seq 115 aa AA seqDB search
MVTQITSFGRSGLYDWMMQRISAIVLALYSVFIIGYLVLNPDLTYEQWSGLFETTWMRIF
SLMTLLSIGIHSWIGLWSVSTDYIKATGVRFLFQAVCGFAMFVYVVWGIQVLWGL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaactcaaattacaagttttggtcgctcaggactttatgattggatgatgcagaga
atttctgcaatcgttttagcgttatacagcgtatttattattgggtatttggttttaaac
cctgaccttacatacgaacagtggagtggactgtttgaaacgacttggatgcgcatcttc
agtttgatgacgctcttgtctattggtattcactcctggattggcttgtggtctgtatct
acagattacattaaagctaccggtgttcgttttcttttccaagcggtgtgcggttttgcg
atgtttgtttatgtcgtttggggtattcaggttctttgggggctgtaa

DBGET integrated database retrieval system