KEGG   Marinomonas mediterranea: Marme_1510Help
Entry
Marme_1510        CDS       T01449                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mme  Marinomonas mediterranea
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:mme01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mme00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mme00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:mme00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1684390..1684737
Genome map
AA seq 115 aa AA seqDB search
MVTQITSFGRSGLYDWMMQRISAIVLALYSVFIIGYLVLNPDLTYEQWSGLFETTWMRIF
SLMTLLSIGIHSWIGLWSVSTDYIKATGVRFLFQAVCGFAMFVYVVWGIQVLWGL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaactcaaattacaagttttggtcgctcaggactttatgattggatgatgcagaga
atttctgcaatcgttttagcgttatacagcgtatttattattgggtatttggttttaaac
cctgaccttacatacgaacagtggagtggactgtttgaaacgacttggatgcgcatcttc
agtttgatgacgctcttgtctattggtattcactcctggattggcttgtggtctgtatct
acagattacattaaagctaccggtgttcgttttcttttccaagcggtgtgcggttttgcg
atgtttgtttatgtcgtttggggtattcaggttctttgggggctgtaa

DBGET integrated database retrieval system