KEGG   Marinomonas mediterranea: Marme_1514Help
Entry
Marme_1514        CDS       T01449                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mme  Marinomonas mediterranea
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marme_1514
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Marme_1514
  Amino acid metabolism
   00310 Lysine degradation
    Marme_1514
Enzymes [BR:mme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Marme_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1690480..1691991
Genome map
AA seq 503 aa AA seqDB search
MSIEIKAPTFPESVADGTVATWHKQPGEACARDEHIVDIETDKVVLEVVAPADGVIVEVL
KGEGDIVLSDEVLAKFESGASAEAAPAAAASAAPAASASAAKETVQIKAPTFPESVADGT
VAAWHKQPGEACARDEHIVDIETDKVVLEVVAPAEGVIGDIVKNEGDTVLSDEILANFLV
GASGAAAAPAEAAAPAAESAGDEDGVAGPAARKALAEAGLSASDVKGTGKGGRITKEDVE
AASKAKAAAPAPAAKPAAAPATMPALGADGRVEKRVPMTRLRATIAKRLVEAQQTAAMLT
TYNEVNMGPVMELRKKYKDLFQKTHNGTKLGFMSFFVKAATEALKRYPAVNASIDGNDMV
YHGYQDIGVAVSTNRGLMVPVLRNTEAMGLADIESGIMDFAVRGRDGKLGMDDMQGGTFT
ITNGGIFGSLMSTPILNPPQTAILGMHKIQERPMAVDGQVVIQPMMYLALSYDHRMIDGK
EAVQFLVTIKDLLEDPSRLLLEI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaaataaaagcacctacttttccagaatctgtagcagacggcacggtcgct
acttggcacaagcaaccaggtgaagcctgtgcacgtgatgagcacatcgttgatatcgag
actgataaagtagttttggaagttgtggctccagcagatggcgtcattgtagaagtactg
aaaggtgaaggtgatatcgttcttagcgatgaagtcttagctaagtttgaatctggtgca
agtgcggaagcagctcctgcagcagcggcaagcgcggcgccagcagcatcagcttctgcg
gcgaaagaaacagtgcaaatcaaagcacctactttccctgagtcagttgctgacggtact
gttgctgcttggcataaacagccaggtgaagcatgtgcacgtgatgagcacattgttgat
atcgaaacagataaagttgttttagaagtcgtagcacctgctgaaggggttatcggtgat
attgttaagaatgaaggcgataccgttcttagcgatgagatattggctaacttccttgtt
ggcgcttctggcgcagcagcggcacctgcagaagcggcagcgcctgcagcagagtctgct
ggtgacgaagatggcgttgcgggtcctgcggctcgtaaagcgttggctgaagcgggtcta
tctgcatcagatgtaaaaggcactggtaaaggtggccgtattacaaaagaagacgtagaa
gcggcttctaaagcgaaagcggctgcgccggctcctgcagctaagcctgctgctgcacct
gcaacaatgcctgcattgggtgctgatggtcgtgtcgagaagcgtgttccaatgactcgc
ttgcgtgcgactattgcaaaacgtcttgttgaagcgcaacaaacggcggctatgttgaca
acgtacaacgaagttaacatgggtcctgtgatggagcttcgtaagaagtacaaagatcta
tttcagaaaactcataacggcactaagttaggctttatgtctttcttcgttaaagccgcg
actgaagctttgaaacgctacccagcggttaacgcttctatcgatggtaacgatatggtt
taccatggttaccaagacatcggtgttgctgtgtcaactaaccgtggcttgatggttcct
gtattgcgtaatacagaagcgatgggcttagcggatattgagtctggtattatggacttt
gcggtacgtggtcgcgacggtaagttgggcatggatgacatgcaaggcggaacctttacc
atcacgaacggtggtatctttggttctcttatgtcaacaccgatcctgaatccaccacaa
actgcaatcttgggaatgcataaaatccaagagcgtcccatggcagtagacggtcaagtc
gttattcagcctatgatgtacttagctttatcttacgaccaccgtatgatcgatggtaaa
gaagccgtgcaattcttggtgacgattaaagatttacttgaagatccatcacgtctgctt
cttgaaatctaa

DBGET integrated database retrieval system