KEGG   Marinomonas mediterranea: Marme_1514Help
Entry
Marme_1514        CDS       T01449                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mme  Marinomonas mediterranea
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mme01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mme00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mme00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1690480..1691991
Genome map
AA seq 503 aa AA seqDB search
MSIEIKAPTFPESVADGTVATWHKQPGEACARDEHIVDIETDKVVLEVVAPADGVIVEVL
KGEGDIVLSDEVLAKFESGASAEAAPAAAASAAPAASASAAKETVQIKAPTFPESVADGT
VAAWHKQPGEACARDEHIVDIETDKVVLEVVAPAEGVIGDIVKNEGDTVLSDEILANFLV
GASGAAAAPAEAAAPAAESAGDEDGVAGPAARKALAEAGLSASDVKGTGKGGRITKEDVE
AASKAKAAAPAPAAKPAAAPATMPALGADGRVEKRVPMTRLRATIAKRLVEAQQTAAMLT
TYNEVNMGPVMELRKKYKDLFQKTHNGTKLGFMSFFVKAATEALKRYPAVNASIDGNDMV
YHGYQDIGVAVSTNRGLMVPVLRNTEAMGLADIESGIMDFAVRGRDGKLGMDDMQGGTFT
ITNGGIFGSLMSTPILNPPQTAILGMHKIQERPMAVDGQVVIQPMMYLALSYDHRMIDGK
EAVQFLVTIKDLLEDPSRLLLEI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaaataaaagcacctacttttccagaatctgtagcagacggcacggtcgct
acttggcacaagcaaccaggtgaagcctgtgcacgtgatgagcacatcgttgatatcgag
actgataaagtagttttggaagttgtggctccagcagatggcgtcattgtagaagtactg
aaaggtgaaggtgatatcgttcttagcgatgaagtcttagctaagtttgaatctggtgca
agtgcggaagcagctcctgcagcagcggcaagcgcggcgccagcagcatcagcttctgcg
gcgaaagaaacagtgcaaatcaaagcacctactttccctgagtcagttgctgacggtact
gttgctgcttggcataaacagccaggtgaagcatgtgcacgtgatgagcacattgttgat
atcgaaacagataaagttgttttagaagtcgtagcacctgctgaaggggttatcggtgat
attgttaagaatgaaggcgataccgttcttagcgatgagatattggctaacttccttgtt
ggcgcttctggcgcagcagcggcacctgcagaagcggcagcgcctgcagcagagtctgct
ggtgacgaagatggcgttgcgggtcctgcggctcgtaaagcgttggctgaagcgggtcta
tctgcatcagatgtaaaaggcactggtaaaggtggccgtattacaaaagaagacgtagaa
gcggcttctaaagcgaaagcggctgcgccggctcctgcagctaagcctgctgctgcacct
gcaacaatgcctgcattgggtgctgatggtcgtgtcgagaagcgtgttccaatgactcgc
ttgcgtgcgactattgcaaaacgtcttgttgaagcgcaacaaacggcggctatgttgaca
acgtacaacgaagttaacatgggtcctgtgatggagcttcgtaagaagtacaaagatcta
tttcagaaaactcataacggcactaagttaggctttatgtctttcttcgttaaagccgcg
actgaagctttgaaacgctacccagcggttaacgcttctatcgatggtaacgatatggtt
taccatggttaccaagacatcggtgttgctgtgtcaactaaccgtggcttgatggttcct
gtattgcgtaatacagaagcgatgggcttagcggatattgagtctggtattatggacttt
gcggtacgtggtcgcgacggtaagttgggcatggatgacatgcaaggcggaacctttacc
atcacgaacggtggtatctttggttctcttatgtcaacaccgatcctgaatccaccacaa
actgcaatcttgggaatgcataaaatccaagagcgtcccatggcagtagacggtcaagtc
gttattcagcctatgatgtacttagctttatcttacgaccaccgtatgatcgatggtaaa
gaagccgtgcaattcttggtgacgattaaagatttacttgaagatccatcacgtctgctt
cttgaaatctaa

DBGET integrated database retrieval system